KEGG   Notothenia coriiceps (black rockcod): 104951950
Entry
104951950         CDS       T04920                                 

Gene name
gpr161
Definition
(RefSeq) G-protein coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104951950 (gpr161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ncc04030]
    104951950 (gpr161)
G protein-coupled receptors [BR:ncc04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    104951950 (gpr161)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 104951950
NCBI-ProteinID: XP_010776997
UniProt: A0A6I9NK77
LinkDB
Position
Unknown
AA seq 525 aa
MNNSRNCTSVGHGEGLAALESVSIVTITLLAGLGNFMIVATLYRRPYLLTPSNKFVFSLT
LSNLLLSMLVLPFVAVSSAKKEWVFGVVWCNFTALLYLLISSASMLTLGAIAIDRYYAVL
YPMIYPMKITGNRAVVVIAYVWLHSLVGCLPPLFGWSSFEFDCYKWTCVASWHKVPSYTA
FWVTWCILPPLFIMLACYGVIFRVARMKARKVHCGTVVVTNDGSNGAQKNGRKNSSTSTS
SNGSRRSLVYAGSQCKAFVTILVVIGTFFISWGPYVGVVCTEAIWGQGSVSQGLETLVAW
LSFCSAVCHPLIYGLWNKTVRKELLGMCFGDRYYRESFATRHRTSRLFSISNRITDLGMS
PHLTAMLAGGGHLLAPGSSTGDTGFSYTQDSCTDVMLLDNFSADGSSQQQNPCNLSVKRR
SSVTFEDQVEQAKAENNNTSSVQIHTQEHESLDNFASCLAMAIESDAKLTMFGEGLALPG
GLFTTRAAPRPRYLDGQRLRLESIDEGIVKDDRDEEEQDMEEKLA
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaacaacagtaggaactgtacctcggtggggcatggggagggtctggctgccctggag
tccgtctccatcgtgaccatcacactcctcgccggcctggggaacttcatgatcgtggcg
accctctatcgaaggccttatctgctcacacccagcaacaagtttgtgttcagcctgacc
ctgtccaacctgttgctgtccatgctggtgctgccattcgtggcagtgagctcggcaaag
aaggagtgggtgtttggggtggtgtggtgtaacttcactgccctgctgtacttactcatc
agctcggccagtatgctcaccctcggagctattgccattgacaggtactatgctgtgctt
tacccaatgatctaccccatgaagatcacaggaaaccgggcagtcgtcgtcatcgcatac
gtgtggctacactccctggtgggctgtctgcctcctctgtttgggtggtcctccttcgag
tttgactgctacaagtggacctgcgttgcttcttggcacaaagtgcccagctacacggcc
ttctgggtcacctggtgcatccttccccccttattcatcatgctggcctgttacggtgta
atcttccgtgttgcacgcatgaaagccaggaaagtacactgtgggacggttgttgtgacc
aacgacggctccaatggagctcagaagaatggacgaaaaaactcaagcacctcgacttct
tctaatgggagccggcggagcctggtgtatgcagggagtcagtgcaaggcctttgtcacc
atcttagtagtcatcggcaccttctttatatcatgggggccatatgttggggtggtgtgt
acggaggctatttggggacaagggagtgtttctcagggactggagactttggtagcgtgg
ctctctttctgcagcgcagtgtgccacccgctcatctacggtctgtggaataaaacggtg
aggaaggagctgctggggatgtgttttggagatcgctactacagggagtcattcgctacg
cggcatagaacgtcccgcctctttagcatctccaacagaataacagatttgggtatgtcg
ccccacctcacagccatgcttgcgggcggagggcatctcctggccccggggagcagcacg
ggggacaccggcttcagttacactcaggactcatgtacagacgtgatgctgctggataac
ttctccgcagacgggtcctcccaacaacagaacccctgcaatctgtctgtgaagaggagg
agctccgtcacttttgaagaccaagtggagcaggccaaagctgaaaacaacaacacatcc
tcagttcaaatccacacacaggaacacgaatctctcgacaacttcgcatcatgtttggcg
atggccatagagagcgacgctaagctcaccatgttcggcgagggtctggctttaccgggg
ggactgtttacgaccagggcagcaccgagacccagatacctggacggtcagagactaagg
ctggaaagtatcgacgaagggatcgttaaagatgacagagatgaagaagagcaggacatg
gaggaaaaactagcctga

DBGET integrated database retrieval system