KEGG   Notothenia coriiceps (black rockcod): 104951971Help
Entry
104951971         CDS       T04920                                 

Definition
(RefSeq) glutamate decarboxylase 1-like isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00250  Alanine, aspartate and glutamate metabolism
ncc00410  beta-Alanine metabolism
ncc00430  Taurine and hypotaurine metabolism
ncc00650  Butanoate metabolism
ncc01100  Metabolic pathways
Module
ncc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104951971
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104951971
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104951971
   00430 Taurine and hypotaurine metabolism
    104951971
Enzymes [BR:ncc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104951971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 104951971
NCBI-ProteinID: XP_010777022
LinkDB All DBs
Position
Unknown
AA seq 583 aa AA seqDB search
MASSEPRATGGEQDPNSANLIPPSTTNEYAWMHGCTRKLGMKICGFLQKNNSLDEKGRLA
GQKNLLSCDNSDRDARFRLTETDFSNLFARDLLPAKNGEEATIQFLLELVDILTNYIKKT
FDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRFFNQL
SSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMIEMVGWPSGEGDGIFSPG
GAISNMYSVMIARYKYYPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAALGFGSENVILL
STDERGRVIPADLEAKILEAKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLH
VDGAWGGGLLMSRKHRHKLSGVERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMC
AGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLY
NKIKNREGYQMVFDGEPQHTNVCFWYIPPSLRGMPEGEERREKLHKVAPKIKAMMMESGT
TMVGYQPQGNKVNFFRMVVSNLAVTQSDIDFLIDEIERMGVDL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtctgaaccgagagccaccggcggggagcaggaccccaactccgccaattta
ataccaccgtccacaaccaacgaatatgcgtggatgcacggatgcacacggaaactgggg
atgaagatttgtgggttcctgcagaagaacaacagcctggatgagaaggggaggctcgcg
gggcagaagaacctgctctcctgcgacaacagtgaccgggacgctcgcttccgcctcacc
gagaccgacttctccaacctcttcgccagagacttactgccagccaaaaatggagaggag
gctacaatacaatttttgttggagttggtggacatcctcaccaactacatcaagaagact
ttcgaccgctccaccaaggtgctggacttccaccaccctcaccagctcctggagggcatg
gagggcttcaacctggagctgtccgaccagcccgaatccctggagcagatcctggtggac
tgcagagacacgctcaaatatggcgtccggacaggtcaccctcgattcttcaaccagctt
tccagtggtctcgatatcatcggtctggccggagagtggctcacctccaccgctaacacc
aacatgttcacctatgagatcgccccggtgtttgtgttgatggagcagctgactctgaag
aagatgatagagatggttggatggcccagtggagagggggatgggatattttctccaggg
ggcgctatctccaacatgtacagtgtgatgatcgcacgttacaagtactaccccgaggtc
aagaccaagggcatgtctgctgctcctcgcctcgtgctcttcacatctgaacacagccat
tactccataaagaaggctggagctgctctgggttttggctctgagaatgtgatcctgctc
agcacagacgagagggggagagtcattcctgcagatctggaggccaagatccttgaggct
aaacagaagggttacgtgccactgtttgtgaatgccaccgctggttccacagtgtacggc
gcgtttgaccccatcaacgagatcgctgacatctgtgagaagtacaacctgtggctccac
gttgacggagcgtggggtggtggacttctgatgtccaggaagcatcgccataagctcagt
ggagtggagcgggccaactctgtcacatggaaccctcacaagatgatgggcgtgcctctg
cagtgctctgccatcctggtcagagagaaggggatcctggcaggatgtaactccatgtgc
gccggctacctgttccaacccgacaaacagtacgatgtcacctacgacacgggggacaaa
gccatccagtgtggccgacacgtcgacatctttaagttctggctcatgtggaaggccaag
ggcaccatcgggtttgagcagcacatcgacaagtgtttggatctctctcagtacctgtac
aacaagatcaagaacagggagggttatcagatggtgtttgatggagagccccagcacacc
aatgtctgcttctggtacatccctccgagcctgagaggcatgcctgagggagaggagcgg
agagagaaactccataaggtggcaccgaagatcaaggccatgatgatggagtcagggacc
accatggtgggctaccagcctcagggcaacaaagtcaacttcttccgcatggtggtgtcc
aatctggcggtcacacagtctgacatcgacttcctcatcgacgagatcgagcggatggga
gtagacctgtag

DBGET integrated database retrieval system