KEGG   Notothenia coriiceps (black rockcod): 104952496
Entry
104952496         CDS       T04920                                 

Gene name
lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2 isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04080  Neuroactive ligand-receptor interaction
ncc04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104952496 (lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104952496 (lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ncc04030]
    104952496 (lpar2)
G protein-coupled receptors [BR:ncc04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    104952496 (lpar2)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 104952496
NCBI-ProteinID: XP_010777628
UniProt: A0A6I9NRS5
LinkDB
Position
Unknown
AA seq 368 aa
MAMESSLWSTCDYSHNVTFFYNLVGKKISVEWAPRDVLVIGLGLTVCLIVVLANLMVMAA
ISMNHRFHFPIYYLLGNMAAADLFAGIAYANLMLHTGPWTSTLTKEQWYIRGALIDISLT
ASVANLLAVAVERHQTIITMQLHSKMTKRRVVLLMVCIWAVSIVMGLVPSLFWNCECDLE
DCSTVAPLYSRRFLIFWAVLNLLTFFIMVAMYTRIFFYVRYQISHMSQHSSEIRHRQTVF
NLMKTISIVLGAFVICWMPGLVTLLLDGLLGKASHANSYEKFCLVIAECNSLVNPIIYSL
RDEEMRRTFKWILCCLCGRGGDKQMELSPVEMNPPLTEEALGCVQKSEDLAVCPETNNKE
SSWTIPGV
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggccatggagagcagtttgtggagtacctgcgactacagccacaatgtcaccttcttc
tacaacttggtgggtaagaagatcagcgtggagtgggcgccgcgggacgtgcttgtgatt
ggactgggcttgactgtatgtctcattgtagtcctggccaacctgatggtgatggcggcc
atctccatgaaccaccgcttccacttccccatctactatctcctaggcaacatggctgca
gctgacctgtttgcagggatcgcctacgccaacctgatgctgcacacgggcccctggacc
agcaccctcaccaaggagcagtggtacatccgaggggctttgatcgacatcagtctgacg
gcctcggtggccaaccttctagcagttgccgtggagcgccaccagactataatcaccatg
cagcttcacagcaagatgactaagcggcgggtggtgctgctgatggtctgcatctgggct
gtgagcatcgtcatggggctggtgccctcgctgttttggaactgcgagtgtgaccttgag
gactgctccaccgtcgctcctctctacagccgccgcttcctcatcttctgggcagttctc
aacctgctcacattcttcatcatggtggccatgtacactcgtatcttcttctatgtgagg
taccagatttcacacatgtcccagcacagctcggagataaggcacaggcagactgttttc
aacctgatgaagactatctccattgtactgggcgcctttgtgatctgctggatgcccggc
ctcgtgacgctcttactggacgggctgttgggcaaagccagtcacgccaactcctacgag
aagttctgtttggtcatagcagagtgcaactctctggtcaaccccatcatctattccttg
cgagacgaggagatgcggaggacgttcaagtggatcctgtgctgcctgtgtgggaggggg
ggggacaagcagatggagctttcacctgtcgagatgaaccccccactgacagaggaagct
cttggctgtgtccagaaatcagaagatctggccgtctgtccagaaacaaacaataaagaa
tccagctggacgataccgggggtctga

DBGET integrated database retrieval system