KEGG   Notothenia coriiceps (black rockcod): 104952807
Entry
104952807         CDS       T04920                                 

Gene name
gsk3b
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04012  ErbB signaling pathway
ncc04110  Cell cycle
ncc04150  mTOR signaling pathway
ncc04310  Wnt signaling pathway
ncc04340  Hedgehog signaling pathway
ncc04510  Focal adhesion
ncc04910  Insulin signaling pathway
ncc04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104952807 (gsk3b)
   04310 Wnt signaling pathway
    104952807 (gsk3b)
   04340 Hedgehog signaling pathway
    104952807 (gsk3b)
   04150 mTOR signaling pathway
    104952807 (gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104952807 (gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104952807 (gsk3b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104952807 (gsk3b)
   04916 Melanogenesis
    104952807 (gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104952807 (gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104952807 (gsk3b)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     104952807 (gsk3b)
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   104952807 (gsk3b)
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104952807 (gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 104952807
NCBI-ProteinID: XP_010778013
UniProt: A0A6I9NSX7
LinkDB
Position
Unknown
AA seq 425 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGEMVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGREK
PSLFNFTTQELSSNPSLASILIPAHARSQAAASTPTNTSATTDGSSTERGPSTTTASASA
SNSTS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgggtcggcctaggaccacatccttcgcggagagctgcaaaccagtgccgcagccc
tcggctttcggcagcatgaaagtcagcagggataaagatggcagcaaggtaacaacagtc
gtggccactcctggtcaaggccctgaccggccacaggaagtgagctacacggacacgaag
gtcatcggcaacggctcgttcggcgtggtctaccaggccaaactctgcgactccggagag
atggtggccatcaagaaggtcctgcaagacaagaggtttaagaatcgggagctgcagatc
atgaggaagttggaccactgcaacatagtccgcctgcgctacttcttctactccagtgga
gacaagaaagatgaggtgtatctgaatttggttctggattacgttcctgagactgtctac
agagtggcccgacactacagccgagccaaacagaccctgcccatggtttatgtcaagttg
tacatgtaccagctgttcaggagcctggcctacatccattcgtttgggatctgtcatcgg
gacatcaagccccaaaatctgctgctggatccagagaccgctgtgctcaagctctgcgac
tttggcagtgccaagcagctggtccgcggggagcctaatgtgtcctacatctgctctcgc
tactatcgagcacctgagctcatcttcggtgccactgactacacctccagcatagatgtg
tggtcagctgggtgcgtgctagcagagctgttgctaggacaaccaatcttccccggtgac
agtggagtggatcagttggttgaaattataaaggttctcggcaccccgacccgagagcag
atccgggagatgaaccccaactacactgagttcaagttcccccagattaaggcacatcct
tggactaaggtgagtcaacaggtgttccggccgcgcacgcctcccgaggccatcgccctg
tgctctcgcctgctggagtacacccccaccgcccgcctcacccctctagaggcctgcgcc
cactctttctttgacgagctgcgcgaccccaacgtcaaactgcccaacgggagagagaag
ccctccctcttcaatttcaccacccaggagttatccagtaatccctctctggcctccata
ctcatcccagcccacgcccgcagccaagcagccgcctccacccccaccaacacctctgcc
accacagatggcagcagcacagagcgaggccccagcaccaccaccgcctccgcctcggca
tccaactcaacctcctga

DBGET integrated database retrieval system