KEGG   Notothenia coriiceps (black rockcod): 104953095Help
Entry
104953095         CDS       T04920                                 

Gene name
ncf1
Definition
(RefSeq) neutrophil cytosol factor 1
  KO
K08011  neutrophil cytosolic factor 1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104953095 (ncf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104953095 (ncf1)
Membrane trafficking [BR:ncc04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    104953095 (ncf1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    104953095 (ncf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NECFESHC SH3_1 SH3_2 SH3_9 p47_phox_C PX FNIP_M
Motif
Other DBs
NCBI-GeneID: 104953095
NCBI-ProteinID: XP_010778320
LinkDB All DBs
Position
Unknown
AA seq 418 aa AA seqDB search
MEASYVRHVELFGFEKRSFPSQHYVYMLMVKWSDLSEKLIYRTYPEIHTFHKSLKEMFPI
ESGEIEKKDRIIPSLPAPRWLISEKSPETRQSTLSEYCHSLINLPPHISRSKQLTNFFKV
RPEDENPPALNPVKKSETFVVNKESYRGNVSEISGPIILDTYRVIADFEKTSKHEINLHT
GDLVEIVEKNPNGWWFCQCESNRGWIPASYLEPLDGPDEAEEADPDYEGEMHVSIRAYKA
ELEDEISLESGETVAVIHKLLDGWWVVRKGDETGHFPSIFLHKAGKREIYEAQRTNLQGQ
KPPPRRSTIRNAKSIHNKSRQRLSQDTYRRNSRRYLQQKGGRLAEPSKNSKTAAKSPLRE
RKNQDNIPEQSTSGSESELKKDAPVIPPRPSPELILERCSDNTCKRVSIHRSNSGSSK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgagctacgtcaggcatgtggagctatttggctttgagaaacgttcattcccg
agtcagcactatgtgtacatgctgatggtgaaatggagtgacctctcagagaagctgatc
tacagaacgtatcctgagattcacacctttcacaagtccctgaaggagatgtttcccatc
gagtctggtgaaatagaaaagaaggacagaataattccgtcattaccagctccacggtgg
ttgatcagtgagaagtctccagagaccaggcagagcacgctgtcggagtactgccactcg
ctcatcaacctgccgcctcacatctcccgcagcaaacagctaaccaacttcttcaaggtc
cgacccgaggacgagaacccgcctgctctgaacccagtgaaaaaaagcgaaacctttgtg
gtgaacaaggagtcgtacagaggcaacgtttctgagatttctggccccatcattttggac
acctacagagtgatcgctgacttcgagaagacgtctaaacatgagattaatctgcacact
ggagacctggtggaaatcgtggagaaaaatccaaatgggtggtggttctgccagtgtgag
tctaatcgaggctggatccctgcgtcttacctggagccgctggacggaccggatgaagca
gaggaggctgatccggactatgaaggagagatgcacgtcagcatcagagcctacaaggca
gagctggaggacgagatctctctggagagcggggaaaccgtcgccgtcatccacaaactg
ctggacggctggtgggtcgtcaggaaaggagatgagaccggacatttcccttcaatattc
ctgcacaaggccggcaagagggagatatatgaagcacagcggacaaacctgcagggacag
aaacctcccccccgcagatccaccatcagaaatgcgaagagcatccacaacaagtctcgt
cagcggctcagccaggacacttaccgcaggaacagccgccgctacctccagcagaaaggg
ggccgcctggcagagcccagcaagaactccaagaccgccgcaaagtcaccgctgagggag
aggaagaaccaggacaacattcccgagcagtccacgtccggctcagagagtgagctgaag
aaggatgctccggttatccccccccggcccagtccggagctcatcctggagcgctgcagc
gacaacacctgcaagagagtcagcatccacaggtcaaactctggctcctccaaatag

DBGET integrated database retrieval system