KEGG   Notothenia coriiceps (black rockcod): 104953104
Entry
104953104         CDS       T04920                                 

Gene name
mgrn1
Definition
(RefSeq) E3 ubiquitin-protein ligase MGRN1 isoform X1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04120  Ubiquitin mediated proteolysis
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104953104 (mgrn1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104953104 (mgrn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ncc04121]
    104953104 (mgrn1)
Enzymes [BR:ncc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104953104 (mgrn1)
Ubiquitin system [BR:ncc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    104953104 (mgrn1)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2 zf-RING_11
Other DBs
NCBI-GeneID: 104953104
NCBI-ProteinID: XP_010778334
UniProt: A0A6I9NL51
LinkDB
Position
Unknown
AA seq 549 aa
MGSILSRRIAGVEDIDIQANSAYRFPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGNRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDSDTPVEEGGKPKVQYGV
EFTFDADARVAITLYCQAFEEFSNGMAVYSPKNPSLVSETVHYKRGVSQQFSMPSFKIDF
TEWKEEDLNFDLDRGVFPIVIQAVVDEGDDCLGHAHVLLAAFERHVDGSFSVKPLKQKQI
VDRVSYLLQEIYGIENKNNQETKQSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCNSC
ADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQTMDHDEHSSTDSVPP
GFEPISLLEALNGMSSVSPAVPSAPLYDDINFSGGLVGDGRQLSSPEHLSDGSLQKGKVS
KSPDSTLRSPSSPIQEEDEEKLSEMSDAQPHTLLSSSPAPTDATAAEDVAESLSPDDEDR
MHSGANILQDCSREHSRLTKTESDPAGDLSLPGSSESTESLKSQSTNCSSQPLLCPTSSL
HMEDEHLNP
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggggtccatcctgagtcgcagaatcgctggtgttgaggatatcgatatccaggccaac
tcggcctatcgatttccaccgaaatctgggaactattttgcgagccacttcttcatggga
ggagaaaagtttgacacaccacatccagagggatacctttttggagaaaacatggacctg
aactttcttggaaataggccagtgcagtttccatatgtgacgcctgcaccccacgagcct
gtcaaaaccctgaggagtctcgtcaatataagaaaggactctctgcgtttggtcaggtat
aaagatgactctgacacacctgtggaggaaggtggaaaaccaaaggttcagtatggtgtg
gagttcacctttgatgctgacgctcgggtggccatcaccctctactgccaggcgtttgag
gagttctccaatgggatggcagtgtacagcccaaagaatccctcactggtctctgaaact
gtgcactacaagcgaggagtgagccaacagttctccatgccgtcttttaaaatagatttc
accgagtggaaagaggaagatctgaactttgaccttgaccgaggagtgtttcccatagta
atccaggctgttgttgatgaaggggacgattgcctcggacatgctcacgtacttttggca
gcctttgaaagacacgttgatggcagtttctctgtcaagccactgaagcagaagcaaatt
gtggatcgtgtgagctacctcttgcaggagatctatgggattgaaaacaaaaacaaccag
gaaaccaagcagtcagacgatgagaacagtgacaacagcaacgagtgtgttgtgtgtctg
tccgacctgcgagacactctcatcctgccctgcagacacctgtgtctctgcaactcctgc
gcagacactctgcgttaccaggccaacaactgccccatctgcaggctgcccttcagagcc
ttgctgcagatcagagctgtgaggaaaaagcccggggctctctcccccgtgtccttcagc
cctgtcctggctcagactatggaccatgacgagcactcaagcacggactcggttcccccg
ggctttgagcccatctctctgctggaggctctgaatggtatgagctcagtgtctcctgcc
gtcccatctgcccccctctatgatgacatcaacttctcaggaggtctggtcggcgacggc
agacagctgagctcccccgagcatttgagtgatggcagtctgcagaaaggcaaagtcagc
aagtcacctgacagcacccttaggtctccatcgtctcccatccaggaagaagatgaggag
aagctgtctgagatgtctgatgcacagccacacacactgctgtccagcagccccgccccc
accgacgccacagctgcagaggatgtggcagaatccctgtctccagatgatgaggacagg
atgcattctggggcaaacatcctacaggactgcagcagagaacacagcaggttgaccaaa
acagagagcgacccagcgggcgacttgtctctgccagggtcatcagagtccacagaaagc
ctgaagagtcagagcactaactgctccagccagcctctcctgtgtcccacaagcagcctt
catatggaagatgagcacctcaacccctga

DBGET integrated database retrieval system