KEGG   Notothenia coriiceps (black rockcod): 104953613
Entry
104953613         CDS       T04920                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11-like
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04114  Oocyte meiosis
ncc04120  Ubiquitin mediated proteolysis
ncc04218  Cellular senescence
ncc04310  Wnt signaling pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104953613
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104953613
   04340 Hedgehog signaling pathway
    104953613
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104953613
   04218 Cellular senescence
    104953613
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ncc04121]
    104953613
   03036 Chromosome and associated proteins [BR:ncc03036]
    104953613
Ubiquitin system [BR:ncc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     104953613
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     104953613
SSDB
Motif
Pfam: Beta-TrCP_D F-box-like WD40 F-box ANAPC4_WD40
Other DBs
NCBI-GeneID: 104953613
NCBI-ProteinID: XP_010778876
UniProt: A0A6I9NWH8
LinkDB
Position
Unknown
AA seq 296 aa
MEPEMEDKTLELMNTSGMDSQTLVDDLSPKKTTVLKISNGPVAVSRKRPSEGNYEKEKEH
CIALFDQWSEADQVEFVERLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENI
LSFLDARSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNR
TPEVPPNSYYHSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIIS
GLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRYDTHSVTE
NT seq 891 nt   +upstreamnt  +downstreamnt
atggagccggagatggaggacaaaacgttggagcttatgaacacgtcagggatggattca
cagaccctcgtggacgatttgtcgccaaagaagaccacagttctcaagattagtaatggt
cctgttgccgtgtcccgcaagcgtccgtcagaggggaactatgaaaaggagaaggaacac
tgcatcgccctgttcgaccagtggtcggaggccgaccaggtggagtttgtcgagcgcctg
atctcccgtatgtgccactaccagcacggccacatcaactcctacctcaaacccatgctg
cagagggacttcatcactgcgctgccagcccaaggcttggatcacatagcggagaacatc
ctgtctttcctggatgcacgctcgctttgctcggcagagttggtgtgtaaggagtggcag
agagtcatctctgagggtatgctgtggaagaagctcatcgaacgcatggtccgcaccgac
ccgctctggaaaggcctgtctgagagacaccagtgggagaaatatctgttcaagaaccgc
acgccagaagtcccacccaactcctactatcactccctttatcccaagatcatccaagac
atagagactatcgaggcaaattggcgatgtggcagacacaacttgcagaggattcagtgt
cgctcagaaaatagtaaaggggtttactgcctccagtacgacgatgacaagatcatcagt
ggccttagagacaattccatcaagatctgggataagcagtctctggagtgtctgaagata
ctgaccggtcacacaggatcagtgttgtgtctgcagtacgacgagagggtcatcgtcacc
gggtcttctgactcgactgtcaggtacgacacacattcagtaaccgaatga

DBGET integrated database retrieval system