KEGG   Notothenia coriiceps (black rockcod): 104953998
Entry
104953998         CDS       T04920                                 

Definition
(RefSeq) zinc finger protein GLI2-like
  KO
K16798  zinc finger protein GLI2
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104953998
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ncc03000]
    104953998
Transcription factors [BR:ncc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    104953998
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 104953998
NCBI-ProteinID: XP_010779345
UniProt: A0A6I9NWH4
LinkDB
Position
Unknown
AA seq 1032 aa
FEGCPKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVC
KIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRSDIPPRQQPPKGNGENEANSKLGGRG
LDGKMEANSTSRGGEDCLQVKSIKTENSMTYQSSPGGHSSCSSEPSPLSSANNNDSGVEM
ALHSGGSFGDLTQDDGPMVDSTVPIGGHLAGVGLQMRKSVGHGGGVTIKLENIKQERLTT
VRDSCPWGNSAPQPLQGQRNSTKLPPIPAVGSLLENSNLITNLGGQYPGQRMGDLSSCEV
TLLNQLNERRDSTTSTMSSAYTMSRRSSGISPCYSSRRSSEASQFGGNRHNNISSADSYD
PISTDLSRRSSEASQCGGVGGGGLPSLLSLTPAQHYRLKAKYAAATGGAPPTPLPNMDRM
SLRTRMALYSDSQEGLSHQLHQPPSGTVPRRCSDIGYGTRSMMPHEVPPHLPRRASDPVR
RSTLDPLSFPRVQRYNSMNSMNPMNCPSPERHQALAMQGYTRSDGSLQRYPFAPRPPSIC
ENVAMENMAVDGMMIGREQSGEEDMVLPDDVVQYLRTQNPGPTSNNSGQGDYHSNNQTHG
HQTSMGPPASFYAQRRMAMVDGTMNHQSGHQMGSVGPHQPFPAPLDNMNKNSMPVQWNEV
SSGTVDTTTKLSKPQQHPLRGNLAVVQQTHNFGSLQGQGQGLGSNQQVVPMSQNMSMQGY
ANHNSQRLMNASHQQQRQQRQCSVNFSDQMSPQQGFGQEAIPNAISGSTSVRPTGSTMGD
PELQSYRARTQADGYPHVNQMDQQQNYSVHFQQQQHVHNAGRGMLQPRPPMEPKTSARQQ
TVTNMMQSSRIPKSSDFSPSHGTGTSEASPKRPSGSASHNRSSENQNSAMFYTDQIHMFE
PNSVSFDAPMSPGASQAPSSNTIAAANIASPGVNHVSSSTVDSSTGGSGGTEHAQIDFDT
MLDDGDHSSLMSGTLSPGLLQSLSQSSSRLTTPRNSVTLPSVPAGIGNMAIGDMNSMLTA
LAEESKFLNMMS
NT seq 3099 nt   +upstreamnt  +downstreamnt
tttgagggctgtccgaaagcttactctcgtctggagaacctcaagacccacctcaggtcc
cacaccggggagaagccatatgtgtgtgaacatgaaggctgcaacaaggccttctccaac
gcctcagaccgggccaagcaccagaaccgcacacactctaatgagaaaccatatgtgtgt
aagatcccgggctgtaccaagcgttacacagaccccagctctctcaggaagcatgttaag
acagtccatggaccggaggcccacgtcaccaagaaacagcgaagcgacatcccccccaga
caacagccccccaaaggcaatggggagaatgaggctaattccaagctcggtggaagaggc
ctggacggcaagatggaggccaacagcacctctagagggggggaggactgcctacaagtc
aaatccatcaagactgagaattctatgacgtatcagtccagtcctgggggccactcgtca
tgcagcagtgagccgtcgcctctcagcagcgcaaacaacaacgacagtggagtagagatg
gccctgcacagcggcggcagctttggggaccttacacaggacgatggccccatggtggac
tctactgttccaatcgggggacatctggctggggtggggcttcagatgaggaaaagtgtg
ggtcatggtggtggggtcacgatcaaactggaaaacatcaagcaggaaaggctgaccaca
gtgagggactcctgcccctggggcaactctgcaccacagccactgcagggccaacgcaac
agcacgaagctacccccaatacctgcagtcggttctctgctggagaactccaacttgatc
actaacctaggcggtcagtaccccggacaacgcatgggggacctgtcttcttgtgaagta
acgctgctgaaccagctcaatgagcggcgtgacagcaccaccagcaccatgagctcagct
tacaccatgagtcggcgctcctccggcatttcaccctgctattccagccgccgttccagt
gaggcgtcccagtttggtggtaaccgccataacaacatcagttcggctgattcctatgac
ccaatctccactgatttgtctcgccgctccagcgaggctagccagtgtggaggtgtcggt
ggaggaggtctcccaagcctcctcagtctgacaccagctcagcattatcgacttaaggca
aagtatgctgctgccactggtggagctccacccactcctttgcctaacatggatcggatg
agcctgaggacccgcatggctctctatagtgactcccaggaaggcttgtcgcaccaactc
catcagcccccttctggaactgtgcctcggcgatgcagtgatattggttatggcacgcgg
agtatgatgccccatgaagtacccccccaccttccacgtcgtgccagcgatccggtgcgt
cgttccacattggaccctctctcctttcccagggttcagcgctataacagcatgaacagc
atgaaccccatgaattgtccatcccctgagcgccaccaggcactggcgatgcagggctat
actcgctcggatggcagcctgcaacgctacccatttgcccccagaccacctagcatttgt
gagaatgtagccatggagaacatggcagtagatgggatgatgattgggcgggagcagagt
ggggaggaggacatggttcttccggatgatgtggtgcagtacctgaggacccaaaatcct
ggccccacaagtaacaactctgggcaaggggactaccattccaacaatcagactcatggc
caccagactagcatgggcccacctgcgtcattttacgcgcagaggagaatggctatggtt
gatggcacgatgaatcatcaatcaggtcatcaaatgggttctgttggcccacaccagccc
ttcccagcaccattggacaatatgaataagaatagcatgccagtgcagtggaacgaggtg
agctcagggactgtcgacaccacaaccaagctctccaaaccacagcagcatcctctccgg
gggaacctagctgttgttcagcagacacacaactttggttccttgcagggacaaggtcag
ggccttggcagcaaccagcaggtagtgcctatgagtcagaacatgtctatgcaggggtat
gctaaccacaacagccagaggctgatgaacgcctcccaccagcagcagaggcagcagagg
cagtgcagtgtgaactttagtgatcaaatgagtcctcagcaaggatttggccaagaagca
atcccaaatgctatatctgggagtaccagcgtgagacctaccgggagcactatgggagat
ccagaactgcaaagttacagagcaaggactcaggctgatggctatcctcatgtgaaccaa
atggatcagcagcaaaattacagcgttcacttccagcagcagcagcatgtccataatgca
ggcagaggaatgttacaacccaggcctcccatggagccgaagactagtgccagacaacaa
acagtgactaacatgatgcaatcgagtcgaatacccaaatcatcggattttagccccagt
catggtactggcacctcagaggcaagcccaaagaggcccagtggctcagcaagccacaac
agaagctctgaaaatcagaactctgctatgttttacacagatcagattcatatgtttgag
ccaaattctgtcagctttgatgcccccatgtcccccggtgccagccaggctccttccagc
aacaccattgctgcagccaacattgcctcaccaggagtcaatcacgtctccagcagtaca
gtggattcttctacgggtggatcaggtggcacggagcatgcccaaatcgactttgacacc
atgctggatgatggggaccactccagcctaatgtcaggcacgctgagtcctggcctcctg
cagagcctctcccagagctcctcccgcctcaccaccccgcgcaactccgtcaccttgcca
tctgtaccggcagggatcggcaacatggccatcggtgacatgaactctatgctcacagcc
ctggctgaagaaagcaaattccttaacatgatgagctga

KEGG   Notothenia coriiceps (black rockcod): 104957933
Entry
104957933         CDS       T04920                                 

Gene name
gli1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104957933 (gli1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ncc03000]
    104957933 (gli1)
Transcription factors [BR:ncc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    104957933 (gli1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 104957933
NCBI-ProteinID: XP_010783909
UniProt: A0A6I9P0J6
LinkDB
Position
Unknown
AA seq 1481 aa
MPVDMQPHQGLYHYETSPSQPSRGIVSSDQSPYSDVTSLRSPLLNGPPQDCRAMYNPMTP
SMTHGSGPGQGIGHCMDQYMRPPQAPPPHSMMGHRGMPPPEGGNSTPYCNQNNMMSSHHN
FCHPGSDQMGSVDGSRFSTPRSILKLSKKRALSISPLSDASVDLQTVIRTSPNSLVAFVN
SRCNPNGASSYGHLSVSAMSPSLGYSSNINCQSRQHFSMYGGGGGTSLGGHTQGPCQASR
LPPHNPRLHVPPKHGHLKTEPGLGLGMDGMNLKSMEERSEGDVASPSSTGTQDPLMGLLD
GRDDMDKDDGKPEPEAIYETNCHWESCIKEFDTQEQLVHHINNEHIHGEKKEFVCHWQEC
SREQRPFKAQYMLVVHMRRHTGEKPHKCTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEH
EGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHITK
KHRGDTGPRPPGSAMTPGCPSSELLLEKEETRREDCKLLIPETALKSQPSPGGQSSCSSE
RSPLGSANNNDSGVEMNLNAAGSLEDLTALEDGVAGGGGEPGSVGTMGMSAQALKRLENL
KIDKLKQIRRPPPPGRCASHKLPALPGPGENVGMCAPSPLLSNRRVMELSNHDLGGGTSI
GCPSNDRRGSGTSSLSSAYTVSRRSSMVSPYLSSRRSSDVSQMGGTGGGGCHHLGPEQSV
GDPLSPETNRRGAPCPGGGGLPGLPILTPAQQYSLKAKYAAATGGPPPTPLPNMEHPITP
GRRGGVLSEYQSQPLPPFLQHGGPRRHSANTEYGTGVIYPHQAPGNHSRRASDPVRSVAD
PQAAPKRFNSLNNIAMMGRRNALLHRGSDTSLSRHLYSPRPPSITENVMMEAMGMEPQIG
SVEARDRSMMMPPGERSFMGYQQQHQTMGGAGASLGNQLSPRHDSPSCPDQGYMQGHYQN
QGGEVPSRAGGNPIGQARPVHSEGISNSLLQQTEYSMSTCQLSPSGPNYPGCGQGGDAGG
PWTDSHNQIQTPNQAIQNQRGMQFVDPSLQPQHTQAHFNNQTGLYNSPDGTHKLTIKPEQ
QFHPGMGGGNACQSAKLQQQRMLLQQTQGYPQPGQVLLRNSNNPSCDFQGPNQNSYPSGG
GLSLGCAGTALTDGQRSETPMLQVKEMMVRNYVQSQQALMWEQQQEQQQQQQQSGIKPPP
LSDNMDMSGQTAMMQLSPQHQNQNLYSNQPYPSYPNQNLVMSPPAHGRGTSSVPPKEQQL
TGLQGSCYGQEMVVPRPPQGRKPLSRQNSLSQVAGSYLGSPPQLSPVHSTSSPRRAVRLP
PVQHPQHTQNEMFSPSNNNNMYYSDQINMDKHMDPQNGPCVNQQHIMGSNLDPTGGTKPL
PMTPYPESGPISNALENLDLDNARIDFTSIIDDADSSSFSPINPPLQGQPGSSTQASSRL
NTPQTSVTLAPGSGLSNMAVGDMTSMLTSLAGENKYLNTLS
NT seq 4446 nt   +upstreamnt  +downstreamnt
atgccagtggacatgcagccacaccaggggctgtatcactacgagacctcacccagccag
ccctccagaggcatagtctcatcagaccagtctccctacagtgatgtgacctcgctgcgt
agcccgctcctcaacggccccccccaggactgccgcgctatgtataaccccatgactccc
agtatgactcatggatctggcccaggccaggggattggccactgcatggatcaatatatg
aggccccctcaggccccaccgccacacagtatgatgggccacaggggcatgccgccccca
gagggtggcaacagtaccccctactgtaaccagaacaacatgatgtcctctcatcacaac
ttctgccatcctggctcagatcagatgggctcagttgatggctcaaggttctccacacct
cgatccatactgaagctgagtaaaaagagagctctgtctatctctcctctgtctgatgcc
agtgtggacctgcagacagtgatccgcacatcacccaactctctggtggcctttgtcaac
tctcgctgcaaccctaatggggccagttcttatgggcacctctctgtgagcgccatgagc
ccgtcccttggctattccagcaatataaactgccaatccaggcaacacttttcaatgtat
ggaggaggcggggggacgtctctgggtggacacacacaaggtccctgccaagcttcccgc
ttacctccccacaatcctcggctccacgttccacccaagcatggacacctgaagacagag
ccagggctgggacttggcatggatggcatgaatttgaagagcatggaggaaaggtcagag
ggtgatgtggccagtccttcttccactggcactcaggaccccctcatgggcctactggat
ggcagagatgacatggacaaggacgacgggaagcctgaaccagaggccatctacgaaacc
aactgccactgggagagctgcatcaaagagtttgacacacaagagcagcttgttcatcac
atcaacaatgagcacatccatggggaaaagaaggagtttgtgtgtcactggcaggagtgc
tctcgagaacagaggccgttcaaagcccagtacatgctggtggttcatatgcgcagacac
acaggagagaagccacataagtgcacttttgaaggctgtaataaggcctactctcgcctg
gagaatttgaagacccatttgcgctctcacacaggagagaaaccatacgtgtgtgaacac
gaaggctgtaacaaagccttctccaacgcttcagatcgggccaagcaccagaaccgaact
cactccaatgagaaaccttatgtatgtaagatccccggctgcactaagcggtacacagat
ccaagctctttgcgtaaacatgtaaagacggtgcacggccctgaagcccacatcaccaag
aagcaccgtggagacacaggacctcgaccccccggttcagctatgacccctggatgcccg
agctctgaactgctgctggagaaagaggagacacgcagggaggactgcaaactgcttatt
cctgagacggctctgaaatcccagcccagccctggtggtcaatcatcctgcagtagcgaa
cgttctccactggggagcgccaacaacaatgacagtggggtggagatgaacctaaatgca
gctggcagtctggaggatctcacagcactggaggatggagttgcaggaggaggaggggag
ccaggaagtgttggaacaatgggaatgtcagcacaggctttgaagaggctggagaatctg
aagattgacaagctgaagcaaatccgcaggccgccccctcctggccgctgtgccagtcac
aaactacctgcacttccgggtccaggggagaatgtgggcatgtgtgcaccttctccactc
ctctcaaatcgaagggttatggaactgtccaatcacgatttaggaggtgggacatcgatt
ggctgcccttcaaatgacagaagaggaagcggcaccagcagcttaagctctgcatatact
gttagccgtcggtcctccatggtctctccttacctttccagccggcgctcaagtgatgtc
tcacaaatgggaggaactggaggcggaggatgtcaccaccttggcccagagcagagtgtg
ggagaccccctctctcctgagaccaatcgcagaggagctccatgtcctggaggaggagga
ttgccaggtcttcctattttaacacctgcccagcaatacagcctaaaggccaaatatgct
gcagcaactggtggaccaccacctactcctttacccaatatggagcacccaattactcca
ggcagaagaggaggtgttttgagtgagtaccagagtcagcctctgcctccattcctccaa
catggtggtccacgtaggcacagtgccaacacagagtatggcactggtgtcatctaccca
caccaggctccaggcaaccacagcaggcgagccagtgaccccgtccgatcagtagcagat
cctcaagctgcccccaagcgcttcaacagcctgaataatatagccatgatgggccgaaga
aatgcgcttctacatcgtggctcagacaccagtctttctcgccatctttactcccctcgg
ccacctagcatcacagagaatgtaatgatggaggctatgggtatggagccccagattggc
tctgttgaagccagggatcgctccatgatgatgccccctggagagagaagcttcatggga
tatcagcaacagcatcaaactatgggaggagctggggcttctctcggaaatcagctgtct
ccaagacatgactctccgagttgcccagaccagggttacatgcagggccactaccagaac
caggggggggaagtcccttccagggctggtggaaatccaataggccaagcaaggcctgtt
cactcggagggcatatccaattcccttctccaacagaccgagtacagcatgagcacatgc
cagcttagcccctcaggccccaattacccaggctgtggccagggtggtgatgctggaggt
ccttggactgattcccacaaccaaatccaaactcccaaccaggctatccagaaccagcga
ggaatgcagtttgtagatcctagcctgcagcctcaacacacacaagcccacttcaacaat
cagacaggcctctacaacagtccagatggaacccacaagcttaccatcaagcctgagcag
cagttccaccctgggatgggaggtggaaatgcctgtcaaagtgctaagctccaacagcag
cggatgctcctccagcagactcaaggttacccacaacctggccaggtcctgctgaggaac
tcaaacaatcccagctgtgactttcaagggccgaaccagaactcctaccccagtggaggg
ggcttgagcttaggctgtgctggtactgcgctgacagatgggcagaggtcagaaaccccc
atgctgcaggtgaaggagatgatggtgagaaactatgtacagtcccaacaagcactcatg
tgggagcagcaacaagaacagcaacaacagcagcagcagagtggaataaaacctcctcct
ctatctgataatatggatatgagtggccagacagcaatgatgcagctaagtccacagcat
caaaatcagaatctctactccaaccagccatatccgtcctaccctaaccagaacctggtc
atgagccccccggcccacggccgagggaccagctctgtgccacctaaagagcagcagctg
acaggtctccaaggctcatgttatggtcaggagatggtggtccccaggcctcctcaggga
cggaaacctctcagccgccagaacagcctgtcacaggtagcagggagctaccttggaagc
ccaccccaactcagccctgtccactccacttccagccccaggcgagcagtccgactccct
ccagtccagcatccacagcacacgcaaaatgaaatgttctctccttccaataacaataac
atgtactattcagatcagataaacatggacaaacacatggacccccagaatggaccttgt
gtcaaccagcagcacattatgggttccaacctggacccaacagggggcacaaaacctctc
cccatgactccctatcctgaatctggccccatctccaatgcgttagaaaacttggacctc
gataacgctcgcatagacttcacctcaatcattgatgatgctgattcttcctcattcagc
ccaatcaaccctccccttcagggtcagccagggtcttccacccaggcctcatcccgcctc
aacaccccccagacttctgttaccctagctccaggctcaggtctgtccaacatggctgta
ggcgacatgacatcaatgctcacctcgctggctggggagaacaaatacctgaacacactg
tcttaa

KEGG   Notothenia coriiceps (black rockcod): 104960362
Entry
104960362         CDS       T04920                                 

Gene name
gli3
Definition
(RefSeq) transcriptional activator GLI3 isoform X1
  KO
K06230  zinc finger protein GLI3
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104960362 (gli3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ncc03000]
    104960362 (gli3)
Transcription factors [BR:ncc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    104960362 (gli3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 104960362
NCBI-ProteinID: XP_010786679
UniProt: A0A6I9P7R8
LinkDB
Position
Unknown
AA seq 1624 aa
METQSQASSAAEKKKRVETIVATKGSSARNDISEKAVASSTTSNEDEHSGPHYHRERRNA
ISSHAPRGGGHDRTISEEPSTSTEERPSLLKKELHGSLPHLTDHGLPYRGTLFTMDPRNG
YLDPHYHSPQFFPAFHPPVPIDDRHTQGRYIYEPSPVPPLHVPPGMAGSPAFSDISLIRI
SPQRNPSVGAESPFHPPHPYINPYMDYIRSLHSSPSISVLSATRGLSPADAPHTGMTTAE
YYHQMALLAGHRSPYATDLLPSVASTAGVTSASALHMEYLQAVENLLLSADSRFPSPRLP
TRPNRKRPLPISPLSEHSFDLQTRIRHSPNSLVTMLNNSRSSSSTSGSYGHLSAGAISPA
LSFAYPPSPVALHVHQQLMGRQPGLVGSAFGHSPPLIHPSPAFATQRPVPGIPPPGLSAS
ERSVLSNDSSQIKPTSESAVSSTGDPMHHKRSKMKPEEEMPSPGALSVQDHPDGMTLVKE
EGDKDESKQEPELVYETNCHWENCCREFDTQEQLVQHINNDHIHGEKKEFVCRWEECSRE
QKPFKAQYMLVVHMRRHTGEKPHKCTFEGCAKAYSRLENLKTHLRSHTGEKPYVCEHEGC
NKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQR
GDYPRPPPPREPGGNSQGRSPGQMGGYTDQREYNHATSKQDECLQVKSIKTEKPMTSQPS
PGGQSTCSSDQSPVSTYPSSGVQLAVSAGRSPGEGLEEDEGREEHEDDFEEECEGEPSPI
MDSTVSTATAAMLTLQARRSVGRPVRWMEHIKMERLKQVNGVLPRLGTLSPTPPPKGSTL
PNILGKESCLGRQWGVSAPQPPAHPELSSTELTVLNLLRDRRDSSGSATSSAYLSSSRRS
SGISPCFSSRRSSQASQSEGTMAASHHRRLHNLSSTDSYDPISTDASRRSSEASHYGGGT
GGGGGGMHLGAGCGGIGGVGMGGVAGSRGMLTLTPAQHYHLKAKYAAATGGPPPTPLPNM
ERMSLKTRMAMMDDGGSNQPLPPLVRPHCCGDGTNGYTNGYVGHAGHRRRVLYPGEGPLN
GNRRASDPVRTQTRDVCNLPPVQRFNSLNNLHPLPPLSHHSSPETRSFGLQNYTRSEGNL
QRGLQHSPYTPSIAEHAALEALAMEDQAGMLLGDEDMLPDDLVQYLHSQAQVDGGSYMHI
EDQLASGQRDVSHPSMEEVELIQTSGLNMAFPGSQSLQQIAERTSPSKLPIQWNEVSSGS
VDRSPQREQNHQTQCGRWSGTDHGTISAPFGRFGNMVVQQQAPLDFPNSCAQANLPQNAC
CVNPGVKLETSPNSCMQMRGTSHNSTNTFGRPNFSQIVDAPLPQAFKQQASNGPQKQSHF
QQNHTTSCQIGNNLILSRTSMDNIPSLSQGTAVHHNRQVHVPRPPIGYRNSVRTQQYLNP
ENCGEQQQLQKSGDHCSLAHQVSGLKLEGPDHGYLEHGFDECLSFEPPDVKAFPILEEQC
LLDSIAESVGQGAGNENTASLLSPGADQVTSTVDGNVPSLLDEGVSLDFGAMLEDGYDQG
SLVSGVLSPSIFQGLSRTSSRLTTPRASATFHSVAPGLNNMAIGDMSSLLTTLAEESKFL
AIMR
NT seq 4875 nt   +upstreamnt  +downstreamnt
atggaaacccagtcccaggccagttcagcagctgaaaagaagaagagggtggagaccatt
gtggcgaccaagggctcatcagcgcgcaatgacatcagcgagaaggcggtggcctccagc
accacctcaaacgaggacgagcattcaggcccgcattaccaccgtgagagacgcaatgcc
atcagctcccacgcaccgagaggggggggccacgacaggaccatcagcgaggagccctct
acctccacagaagaacgcccctccctgctcaagaaggagctgcatgggtccctgccccac
ctgactgaccatggccttccgtaccgaggcactctgttcaccatggacccccgcaacggc
tacctagacccacactatcattccccgcagttcttccctgccttccatcctcctgtgccc
atcgatgacagacatacgcagggacgttacatctacgagccttcccctgtgccccctctt
catgtgcctcctgggatggcgggcagtccggctttctctgacatctccctcatccggatc
tcgccccagcggaacccctccgtgggggcggagtcgccctttcaccctccgcacccctac
atcaacccatacatggactacatccgctcgctccacagcagcccttccatctccgtcctg
tcagccacccggggcctcagccctgcagatgcccctcacacaggtatgaccacagcagag
tactaccaccagatggccctgctcgccggccaccgcagtccttacgccaccgacctgctc
ccctcagtggcgtccacagcgggcgtcaccagcgccagcgccctgcacatggagtacctg
caggcagtggaaaatctcctcctctctgcagattctcgattcccgagccccaggctgcca
acgcggccaaacaggaagcgccccctgcccatctcccccctctctgagcacagcttcgac
ctgcagacgagaatccgccactcccccaactctctcgtcaccatgctcaacaactcccgc
tccagctcgtccaccagcggctcctacggtcacctctctgcgggagccatcagcccggca
ttaagcttcgcctaccctccatccccggtggcgttgcacgtgcaccagcagctgatgggc
cgtcagccggggctcgtgggctctgctttcggccacagcccgcctcttatccacccgtcg
ccggccttcgccacccagaggcccgtccccggtatcccacccccagggctcagcgcgagc
gagcgctcagtcctctccaacgactcctcacagatcaaaccaacaagtgaatctgcagtg
agcagcacaggggacccaatgcaccacaaacgctccaaaatgaaaccagaggaagagatg
ccgagcccaggcgcactgagcgtacaagaccatccggatgggatgaccctggtgaaagag
gaaggggacaaggatgaaagcaaacaggagccagagctggtttatgagacaaactgccac
tgggagaactgttgccgcgagtttgacacgcaggagcagctagtacaacacatcaacaat
gaccacatccatggggagaagaaggagtttgtgtgtcggtgggaggaatgttctcgagag
cagaagcccttcaaggcgcagtacatgctggtggtccacatgcgcaggcatactggggaa
aaaccccacaagtgcacgtttgagggctgtgccaaggcctactcccgtctcgaaaacctt
aaaactcacttacgctcgcacaccggagagaaaccgtatgtgtgtgaacacgaaggctgc
aacaaggccttttccaatgcctcagaccgggcgaaacaccagaatcgcacacactcaaac
gagaaaccatatgtgtgcaaaatcccaggctgcaccaaacgctacacggatcctagctcc
ttacgcaagcacgtgaagacggtgcacggaccggaggcgcacgtcaccaagaaacagcgt
ggagattacccgcgtcctccaccaccccgggagcctgggggcaacagccagggccggtcg
ccagggcaaatgggtggttacacggaccaaagggagtacaaccatgctacctcaaaacag
gatgaatgtctgcaggtcaagtctatcaagacagagaagcctatgacgtctcagccaagc
cctggcggtcagtctacatgcagcagtgaccagtcccccgtcagcacctatcccagcagt
ggagtccagcttgctgtgagcgccggacgctcgccaggggaggggctagaggaggacgag
gggagagaagaacacgaagatgattttgaggaggagtgtgagggtgagccaagccccatc
atggactccacagtctccacggcaacagcggccatgctgaccctgcaggcaaggcgcagt
gtgggccgccctgtgcgctggatggagcacatcaagatggagaggctgaagcaggtgaac
ggagtgctgcccaggctggggaccctgtcccctacaccgcccccaaaaggttccacacta
cccaatatcctggggaaggaatcctgtctgggcaggcagtggggggtgtctgctcctcag
ccacctgctcatcctgagctgagcagcacagagctaacagtgctcaatttgctccgagac
cggcgtgacagcagtggtagcgccaccagttcggcctacctgagcagcagtcggcgctcc
tcaggtatctccccctgcttctccagtcgacgctccagccaggcttcccagagtgagggt
acgatggctgcaagccaccaccgccgcctccacaacctcagctccaccgactcatacgac
cccatctccactgatgcctcccgccggtcaagcgaggcgagtcactatggaggtgggaca
ggaggagggggtggagggatgcacctaggtgcgggctgtggaggtataggaggagtaggt
atgggaggagtagcagggtcaaggggtatgctcactttaacaccagcacagcactaccac
ctgaaagccaagtatgcagcagccactggtggcccacctcccacgcctcttcctaacatg
gagcgcatgagcttgaagacgcgcatggccatgatggatgatggtggtagcaaccagcct
ttaccgccactagtcaggccacattgctgcggtgatggcaccaacgggtacaccaatggg
tatgtgggtcatgcaggtcatcggaggagagtcctctatcctggcgaggggccactgaat
gggaaccggagggccagcgacccagtgcggacgcagactcgcgacgtttgcaatctgcca
ccagtgcaacgcttcaacagcctcaacaacctccaccctcttccgcccttgtcccatcat
tcgtcccctgaaacccgcagctttggcctacagaactacacgcgatcagagggcaacctt
cagagaggcctgcagcactcaccgtacactcctagcatcgcagaacacgcagctttagaa
gcactggccatggaggatcaggctggcatgttacttggggatgaggatatgctgccagat
gacctggtgcagtatcttcactcccaggctcaggtggatggtggctcctatatgcacatt
gaggaccaattagcttctggccaaagggacgtctcccatccatctatggaggaagtagaa
ctgatccagacatcagggttgaatatggcctttcctggatcccaaagtctccagcagata
gcagagcggacaagcccgagtaagcttcccatccagtggaatgaagtgagctctggcagt
gttgacaggtctcctcagagagaacaaaaccaccaaacacagtgtggaaggtggtctggc
acagaccatggaacaatatctgcaccttttggcaggtttggaaacatggtggttcagcag
caagcgccccttgatttcccgaacagttgtgctcaggctaatctgcctcaaaatgcttgt
tgtgtcaaccctggggttaagcttgaaacatcacctaactcctgcatgcagatgagaggt
actagtcacaactctacaaacacctttggaaggcctaacttctcacagatcgtagacgcg
cctcttccgcaggccttcaaacagcaggcctccaatggacctcagaagcagagccacttc
caacagaaccacaccacctcttgccaaattgggaacaaccttatccttagcaggacctct
atggacaacatccccagcctctcccagggaactgctgttcatcacaatcgacaggtccat
gtccctcgcccaccgatcggttacaggaattcagtgcggacccagcagtacctcaaccca
gagaactgtggtgaacagcaacaattgcagaaaagtggggaccactgttcccttgcgcat
caggtatctgggctgaaactagagggcccagaccatggatacttagagcatggctttgat
gaatgcctctctttcgaaccaccagatgttaaggcgttccctatcctagaggagcagtgc
ttgctggactccatagctgagtctgtgggacaaggtgctggcaacgagaacacggcaagc
ctgctctcccctggtgcagaccaggtgaccagcacagtggatggcaatgtgcccagttta
ttagatgagggcgtaagtctagactttggtgccatgctggaggatggctatgaccagggt
agcctggtctcaggagtgttgagtccctccatcttccagggtctgtccaggacctcatca
cgcctgaccacgcctcgagcatctgcgaccttccacagtgtggcccccggcctgaacaac
atggcgatcggagacatgagctctctgctcaccacactggctgaggagagcaagttcctg
gctatcatgcggtag

DBGET integrated database retrieval system