KEGG   Notothenia coriiceps (black rockcod): 104954606
Entry
104954606         CDS       T04920                                 

Gene name
disp1
Definition
(RefSeq) protein dispatched homolog 1
  KO
K24680  protein dispatched 1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104954606 (disp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ncc04990]
    104954606 (disp1)
Domain-containing proteins not elsewhere classified [BR:ncc04990]
 Other domain-containing proteins
  Patched domain-containing proteins
   104954606 (disp1)
SSDB
Motif
Pfam: Patched MMPL Sterol-sensing
Other DBs
NCBI-GeneID: 104954606
NCBI-ProteinID: XP_010780058
UniProt: A0A6I9NZ60
LinkDB
Position
Unknown
AA seq 1389 aa
MSLLAPKSLQICFLSPVALIPICKPDLSPVFLFFSPARPFRFPKSYAELIADWPVVVLGV
CTVLIVVCALVGVLVPDLPDFSDPLLGFEPRGTAIGQRLVTWNNMVKNTGYRATLANYPF
KYADEQAKNHQEPRWPEERFDRDKRQAEWDFSKEFFCDVPGDSYSRLVFASAEGKNLWNI
QAIKSMCNLDNTKVRSHRDYWSLCQRTNDASCCPSWTLGNYVAALTNRSSCQKITERDVA
HTLKILRSCAKYYHNGTLGPECWDMALRRKDQLKCGTVPRKCTKYNAVYQILHFLVDKDF
LSTKSLEFSPPMLKYSMLFSPTEKGESMMNIYLDNFENWNSSDGITTVTGIEFGIKHDLF
QDYLLTDTVYPAIAIVIVLLVMCVYTRSIFITLMTIIAIISSLIVSYFLYRMVFNFEFFP
FMNLTALIILVGIGADDAFVLCDVWNYTKFDKPHAELSETVGVTLQHAALSMFVTSFTTS
AAFYANYVSNITAIRCFGVYAGTAILVNYILMVTWLPAVVVLHERYLPNLFPCAKPQEPQ
SGCCTRTFWTGLCQKANDCLFAVSEASRIFFEKVLPCIVIKLRYLWLFWFLAITVGGAYV
VCVNPKMKLPSLELAEFQVFRSSHPFERYDAEYKKLFMFERVHHGEDLHMPITIIWGVTP
EDNGDPLNPKNKGKLMLDNSFNIASPASQLWILSFCQKLRNQSFVFQSDEQDFTSCFIET
FKQWMENQDCEESPVYPCCSQSTFPYKQEVFELCIKRAIMELDRSTNYHLDSKTPGPRFD
INDTIRAIVLEFKSTYLFTLAYEKMFQFYREVDAWILEELRYAPEGLSHGWFISNLEFYD
LQDSLSDGTLVAMALSVAVAFSVMLLTTWNVIISLYAILSIAGTIFVTVGSLVLLGWELN
VLESVTISVAVGLSVDFAVHYGVAYRLAPEPDREGKVIFSLSRMGSAIAMAALTTFVAGA
MMMPSTVLAYTQLGTFMMLIMCISWAFATFFFQCMCRCLGPQGTCGQIPLPKKMQCQVFS
EVTSSVPAPQGKGKYQLDSRDGEAEHYELEPLASSQKSEDKPREEQEVGAQLYNGVPAHP
HTGPFPHIQYTSKAEPGRTGPENGLAAALRPPSRCQFSQNTTCTCGDPSPSHHLSQQWTP
HSCAQPPLEPPPTPQLFPLSGNTPSKQNAAHLDPVYTHMDCHMHYVHCPPAHFHHCAQGR
VVAPRQGPAHTCNLRKYCVHAAGQQKATALTQEPGSEPGGPGDHKHETSSSSPDSSQNIS
PPAVTQCPSPSPDSPLSQEKQMGRDSDHCCGENHTSTTDTTTPVDACCKVPGNQEQLRSI
PVTREESGKKCKRSSKRQRASSASPKKLYCFNRTLKVKCNSASEFNGPKTDTSVPPIAIN
TNPSSESLC
NT seq 4170 nt   +upstreamnt  +downstreamnt
atgtcccttctcgctccaaagtctctgcaaatctgttttttatctcctgttgcgttgatt
ccaatatgtaagcctgatttatctcccgtctttttgtttttcagccctgcaaggcccttt
cgattccccaaaagctatgctgagctgatagctgattggccggtggtggtgctgggggtg
tgcacagtgctcatcgtggtgtgtgctctggtgggcgttctggttccagatctgcccgat
ttctccgacccgctgctgggtttcgagccaaggggaacagccattggccagcggctggtc
acatggaacaacatggtgaagaacacgggctacagagccacgctggccaactaccccttc
aaatacgctgatgagcaggccaaaaatcatcaagagcccaggtggcccgaggaacgcttt
gatcgagacaaacggcaagcagagtgggacttcagtaaagagtttttctgtgacgtgcca
ggtgacagttactctagactggtgttcgcatcagctgaggggaagaacctgtggaatatt
caggccatcaaatccatgtgcaacctggacaacacaaaggtgcgttcccaccgtgactac
tggagcctctgtcagcgcaccaacgacgcctcctgctgtcccagctggacgctcggtaac
tatgttgccgcgctcaccaacaggtcgtcctgccagaagatcacagagcgcgacgtagcg
cacactctcaagatcctacgctcttgtgctaagtactaccacaacggcaccctggggccc
gagtgctgggatatggccctgcgacggaaggaccagctcaaatgtggcaccgtgcccagg
aagtgcaccaagtacaacgccgtctaccagatccttcacttccttgtggacaaagacttc
ttgagtaccaagagcctggagttttctccccctatgctcaaatacagcatgctcttctcc
cccacagagaagggagagtccatgatgaacatttacttggacaattttgagaactggaat
tcttcagacggaatcaccacagtcacagggattgagtttgggatcaaacacgacctcttt
caggactacctcctcacagacacggtgtatcccgccatcgccatcgtgatcgtcctgttg
gtcatgtgtgtgtacacgcgctccatcttcatcactctgatgacgataatcgccatcatc
agctcactcattgtgtcttactttctttaccggatggttttcaactttgagttcttcccc
ttcatgaacctcacggccctcatcatcctggtgggcatcggtgcagacgacgccttcgtg
ttgtgcgatgtttggaactatacgaagtttgacaagccgcacgccgagctatcagagaca
gtgggagtgactctccaacatgccgccctgtctatgttcgtcaccagcttcaccacctct
gcagctttttacgccaactacgtcagcaacatcactgccatacgctgtttcggtgtctat
gcgggcactgccatattggtgaactacattctcatggtcacatggcttccagctgtggtg
gtgctacacgagcgctacctgccgaatttgttcccgtgcgccaagcctcaggagccgcag
agtggatgctgcacccggacgttctggacaggtctttgtcagaaggccaacgactgcctg
ttcgctgtctccgaggcatcacggatcttcttcgagaaggttctcccctgcatcgtcatc
aaactgcgctacctctggctcttctggttcctcgccatcacagtgggcggggcttatgtt
gtctgtgtcaacccaaagatgaagctcccatctctggaattggccgagtttcaggtgttc
cgatcctcgcacccgtttgagcgctacgacgccgagtacaagaagctgttcatgttcgag
agggttcatcacggcgaggacctccacatgcccatcaccatcatctggggcgtgaccccc
gaggataacggggaccccctgaaccccaaaaacaaggggaagctgatgctggataacagc
ttcaacattgccagtcctgcgtcccagctgtggatcctcagcttctgccagaagctgagg
aatcagagctttgtgttccagtcagacgagcaggacttcaccagctgcttcatcgagacc
ttcaaacagtggatggagaaccaggactgtgaggagtcccccgtctacccctgctgcagt
cagtccaccttcccctacaaacaggaagtgttcgagctgtgcatcaagagagccatcatg
gagctggaccggagcactaactaccaccttgacagcaagacccccggcccacgattcgac
atcaacgacaccatcagagccatagtgttggagttcaagagcacctacctcttcaccctg
gcctacgagaagatgttccagttctacagagaagtggatgcctggatccttgaggagctc
cgctacgccccagaaggcctgagccacggctggttcatcagcaacctggagttctacgac
ctccaggacagtctgtctgacggcactctggttgccatggcgctgtcagtggctgtggct
ttcagcgtgatgctgctcaccacctggaacgtcatcatcagtctgtacgccatcctgtcc
atcgctgggaccatattcgtcaccgtgggctccctggtgctgctgggctgggagctgaac
gtcctggagtcggtcaccatctccgtggcggtggggctgtccgtagacttcgcggtccac
tacggtgtagcctatcgcctcgcccccgagcccgaccgcgagggaaaggtgatcttctcc
cttagccgtatgggttccgctatcgccatggcggccctcaccacctttgtggccggggcc
atgatgatgccctccaccgtgctggcctacacccagctgggcaccttcatgatgctgatc
atgtgcatcagctgggccttcgccactttcttctttcagtgcatgtgtcgctgcctgggg
ccccaggggacctgcggccagatccccctgcctaaaaagatgcagtgtcaggtgttttct
gaggtcacatcttcggtgcctgcccctcaagggaaagggaagtaccagctggacagcagg
gacggggaggcagagcattacgagctggagcccctggcctccagtcagaagagtgaagac
aaaccccgagaggagcaggaagtgggcgctcagctctacaacggggtcccggcccacccc
cacaccgggcccttcccacacatccagtacacaagcaaggcagagccgggcagaacgggc
cctgagaacggcctcgctgcggccctgaggccaccgtccaggtgccagttctctcagaac
actacctgcacatgtggggacccttccccttctcaccacctgtcccagcaatggaccccc
cactcctgtgctcagccccccctggagccccctcccacccctcagctcttccccctctca
ggaaacacccccagcaaacagaacgcagcccatttagacccagtgtacacgcacatggac
tgccacatgcactacgtccactgcccccccgcccatttccaccactgtgcccagggacgg
gtagtggcccccaggcagggacccgcccacacctgtaatctcaggaagtactgcgtccac
gctgctggccagcagaaggctacagctctgacccaggagcccggctcagagcccgggggg
ccaggggaccataaacatgaaacaagttcctcaagccctgacagtagccaaaatatcagc
ccccccgccgtgactcagtgcccatccccctccccggactcacctctcagtcaggagaaa
cagatgggaagggacagtgaccattgttgtggagagaatcacacgtccaccactgacacg
accacaccagtggacgcttgttgtaaagtccctggcaaccaggagcagctcagaagtatt
cccgtcacacgggaggagagcgggaaaaagtgcaagcgcagctctaaacgacagcgggcg
tcctccgcctcgccaaagaaactctactgttttaacaggacgttgaaagtgaagtgcaat
tcagcttcagagtttaacggcccaaaaactgacaccagcgtgcctcctatcgcaataaac
accaatccctcctcggaaagcttgtgttga

DBGET integrated database retrieval system