KEGG   Notothenia coriiceps (black rockcod): 104954911Help
Entry
104954911         CDS       T04920                                 

Gene name
lct
Definition
(RefSeq) lactase-phlorizin hydrolase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00052  Galactose metabolism
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104954911 (lct)
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     104954911 (lct)
    3.2.1.108  lactase
     104954911 (lct)
Chaperones and folding catalysts [BR:ncc03110]
 Intramolecular chaperones
  Others
   104954911 (lct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 R3H
Motif
Other DBs
NCBI-GeneID: 104954911
NCBI-ProteinID: XP_010780417
LinkDB All DBs
Position
Unknown
AA seq 1815 aa AA seqDB search
MQLSQYLLWVALLFSFGMYGCCNEFNPQEDFMLVAGPLNDTFDCSRPVLPGFEQHFEHFE
YLQSRGVTHFKVPLSWVQLLPTGFPGHPQQAVVTCYQTLMKQLLEVGLQPLVVLHGSTVP
DSLRSRYGGWENPELGDMFQQYAEFVFGEFGELALSWVTFSDLDYVRHDPGPLQTILKLN
KNIYQLYHQRFPEKGRRLSIGLRASDVAILPKIKSSTKMDFLSIHIEYECESANLGEELR
RVQVSSGDLPILIYEMTVHGCPYSQYQVLGNFLQVLMSNADLKIVGCDTVDMLGEPETED
FPTSHAISDINRISALRNNYQNVWNQFAAQTDRDLFLNESFPVDFQWATSSESFKVEGGW
AEDGKGESIWDRFGHDGLAFANQTADLACDSYHKVDYDVYLLRGLHVNTYQFSISWARIF
PSGHRCSQSEKGALYYDKLINALIDSGIQPVVTLYHWDLPQALQDCGGWTNASIVEAFKD
YADFCFSRFGDRVKTWNTFSSPWVVSHAGYGTGEHAPGVKDYVVASYQATHNMIKSHAEA
WHVYNEKYRKTQGGRVGIALNSDWAEPVDPSRPEDIAAADRYLQFMLGWFAHPIFVDGDY
PAAFKTQIEQKIKECPLSEPAILPVFTAEERKRIHGTADYFGLNHYTSRLVNNSVGGCTP
GPQGVGNFQSHVDPSWSSTASDWIYSAPWGLRRLLNYISTEYLNIIKVPIHITGNGMPTE
HIGDSLNDVSRIDYMKSHINEALKAIFLDGVNVQRFTAESLMDGFEGKKGYSQRFGLHYV
NFEDADGPRTPKQSAYFYSQVIKQNGFGGHKGEFFNSAKMRFTPRTTALPPSEVPSKSKV
VWEKFSIRSNFQRKLYHYGTFPQGFSWGVSSSAYQIEGGWNADGKGPSVWGYDSTQNGNI
PDNANGDVACDSYHRLEEDSYMLRALKVKSYRFSLSWSRIFPDGQRTSLNQKGVDYYNRL
IDGLLAYNITPMVTLYHWDLPEALQKLGGWDNVEMINIFNDFADFCFATFGDRVTFWMTF
NQPHTIAWSGYGLGQIPPNVTNPGIAPYRVAHNLIKAHAKAYHTYDDKYRASQGGLISIA
LNADWFEPKYVNVPREVVAADRALQFQLGWFAHPIFKNGDYPDAMKWQVGNKSELQGLKE
TRLPSFSEEEKMFIKGTADMFCVNHYTTKIAQHATLRLNPASYIYDQDMSEAEESDSPTT
AIKNQRAVAWGLRRLLNWIKEEYGDPEIYITENGVATNSKTTWDDSARVFYFKTYVDEAL
KAYDLDGVKVKGYIATSLMDSFEWLNGYKVGFGLHHVDFTNPIRPRTPKYSAHFYYQVIK
DNGFPSTDEDQLIYGHFRKDFIWSTATASYQIEGGWRADGKGLSIWDKFAHTPLRVFNDD
NGDIACNSYNKVEEDVAILKQLKVTHYRFSISWPRVLPDGTTKHINEAGLNYYHRLVNAL
LAANIQPHITLYHWDLPQALQDIGGWENDTIVGKFRDYADLIFSRLGHKVKFWITINEPY
NVANIGHGYGAAAPGISFRPGTLPYIVGHSLLKAHAEAWHLYNDKYRAKQQGIISITINS
DWSEPRNPYKQEDIDAAKRVVQFYIGWFAHPVFNGDYSNMMKTIIRERSLAANLTTSRLP
EFTPAEIKRIKGTYDYFGFNHYTTVLAFPVNYGNLQHYDADRGTGTIADRSWLDSGSSWL
KVSPFGFRRILNFIKAEYGNPPIIITENGISERGPIDLNDTLRSYYYEQYINQLLKAYLL
DNVDIRGYTAWSLMDNLEWATGFSERFGLFYVNHSDTKLSRVAKNSVTHYSTIINCNGFP
DPALGPHECFNPAPE
NT seq 5446 nt NT seq  +upstreamnt  +downstreamnt
atgcagttatcacaatacctattatgggttgctttgctgttttcttttggtatgtacggt
tgttgcaatgagtttaacccgcaggaagacttcatgcttgttgcgggccccctgaacgat
acattcgactgcagtcgtccagtacttccaggctttgaacagcactttgagcactttgag
tacctccagagcagaggggtgacccacttcaaagtaccgctgtcatgggttcaactcctt
cctacaggcttccccggacacccgcagcaggccgtggtcacctgctaccagaccctgatg
aaacagctgctggaagtgggccttcagcctctggtggtcctgcatggatccacagtgcca
gactctctgagatcaaggtatggaggctgggagaaccctgagctgggagacatgttccag
cagtacgctgagtttgtgtttggagagtttggagagctggcactctcctgggtgacattt
agcgacttggattatgttaggcatgaccctggtcctctgcaaactatcctgaaactcaac
aagaacatttaccagctctaccatcaacgatttcctgaaaaagggagacgtctgtctatt
ggtttgagagctagtgatgtggcaatccttcccaagataaaaagttcaaccaagatggat
ttcttgtcaattcacattgaatatgaatgtgaatcagcaaaccttggtgaggagctgagg
agagtacaggtgtccagtggagacttgcctatcctcatatacgagatgactgttcacggt
tgtccctacagtcaatatcaggttcttggcaatttcttacaagtgttaatgagcaacgct
gacctgaagattgtcggatgtgacacagtggatatgttgggtgagccggagacggaggac
ttcccaaccagtcatgccatttcagacatcaatagaatttcagcattaagaaacaattat
cagaatgtgtggaatcagtttgcggctcaaactgatcgggatctcttcctgaacgaatcc
tttcctgttgacttccaatgggccacctccagcgagtccttcaaggtggagggaggctgg
gcagaagatgggaagggggagtccatttgggatcgttttggtcatgatggtctagccttt
gccaatcagaccgctgatctcgcttgtgacagttaccacaaggtggattatgatgtatac
ctcctgcgaggtcttcatgttaacacctaccagttttccatctcttgggctcgtattttc
ccctcgggccaccggtgcagtcagtcggagaaaggtgctctctactatgacaagctgatc
aatgctctcattgattctggtatacaacctgttgtcactctctaccactgggatctgccc
caggccctccaggactgtggtggatggaccaacgcttccattgttgaagccttcaaagac
tacgcagatttctgcttctccaggttcggagacagagtcaagacctggaacactttcagt
agcccctgggtggtgagccatgctgggtacggcactggtgagcatgccccaggagtgaaa
gactatgtggtggcctcataccaggcgactcacaacatgatcaaatcccatgctgaggcc
tggcatgtctacaatgagaagtacaggaagacacaaggaggcagagtgggcattgcattg
aactctgactgggctgaacccgtggacccctccagaccagaagacatcgcagctgcagat
cgctacctgcagttcatgctgggctggtttgcacatcccatatttgtcgatggagattat
cctgcagcattcaagactcaaattgaacagaaaataaaagagtgtcctctctctgagcct
gcaatactcccagtcttcacagctgaagagaggaagaggatacacggaaccgctgactat
tttggattgaaccattatacctcccggttagtcaacaacagtgttggtggctgcacccct
ggtcctcagggggttggcaacttccagtcacacgtagatccctcatggtcctcaacagct
tctgactggatatattctgcaccttggggtctcagaaggcttttaaactacatttccaca
gagtatttgaacattatcaaagtgcctatacacattactgggaatggtatgcctactgag
cacattggggacagtctgaatgatgtcagtagaatagactacatgaagagtcacatcaat
gaggcccttaaagccattttcttagatggagtgaatgtgcagcgattcacagcggagtca
ctcatggatggctttgagggaaaaaaaggctacagccaaaggtttggtcttcattatgtc
aactttgaagatgcagacggaccaagaaccccgaagcaatctgcatatttctactctcag
gttataaagcaaaatggatttggtggccacaagggggagttttttaattcggcaaagatg
cgatttactccccgtacaactgctttaccaccctcagaggttccctctaaatcaaaggtt
gtctgggagaaattctcaattcggtcaaattttcagagaaaactctaccactacggcact
ttcccacaaggcttcagttggggagtatcatcttcggcctaccagattgaaggtggctgg
aatgctgatgggaaggggcccagcgtctggggatacgattcgacccaaaatggcaatatt
ccagataatgctaatggggatgtggcctgtgacagctaccacagacttgaagaagactcc
tacatgctgcgtgctctgaaggtgaagtcgtacagattctctttgtcctggtccaggatc
tttcctgatggtcagcgtacatctctgaaccagaaaggtgttgactattacaatagactc
attgatggcctcttagcatataacatcactcccatggtgacactgtaccactgggacctt
cctgaagctttgcaaaaacttggtggctgggacaatgtagagatgattaacatttttaac
gactttgctgacttctgctttgccacctttggcgacagagtgacattctggatgaccttc
aaccagcctcatacaattgcgtggtcaggatatggacttggacagatcccacccaatgtt
acaaatccaggaattgcaccatacagagttgcacacaaccttataaaggcccacgccaag
gcttaccacacatatgatgataagtatcgtgcatcccaaggtggtcttatatccattgcc
cttaatgctgattggtttgaacctaaatatgttaatgttcctcgtgaagtggtggctgct
gaccgcgctctacagttccaattaggttggtttgcacaccctattttcaagaacggtgac
tatcctgatgccatgaaatggcaagttggaaacaaaagtgagctccaaggtcttaaagag
acaagactaccttcatttagcgaagaagaaaagatgttcatcaagggaactgctgacatg
ttctgtgtaaatcattacactacaaaaattgcacagcatgctacattgagacttaaccct
gcatcatatatatatgaccaggacatgtcagaagcagaggaaagtgattcaccaactact
gccatcaagaaccagagagctgtcgcatggggcttgaggagactcctcaactggatcaaa
gaggagtatggagatccagagatttacattactgagaatggagttgctacaaattcaaag
acaacttgggatgactctgccagagtattttatttcaagacctatgttgatgaggctctg
aaagcatatgaccttgatggtgtgaaggtaaaaggatacatagcaacatctctcatggat
tcctttgagtggctcaacgggtacaaagtaggatttgggctgcaccatgtggacttcact
aacccaatccgtccgaggacacccaagtactcagctcatttctactaccaagtcataaag
gacaatggcttcccgtcaacagatgaagaccaactcatttatggccatttccgcaaagat
tttatttggagtactgcaacagcatcataccagattgaagggggatggagagcagatgga
aaaggcctcagcatctgggacaagtttgctcacactcctctcagagtgttcaatgatgat
aatggggacatagcgtgcaacagttacaacaaagtagaagaggatgttgctatattgaag
caacttaaggtgacacattatcgtttctccatatcctggccgagggtgcttcctgatggc
acaaccaagcacatcaacgaggctggactcaactactaccacagactggtgaatgcactg
ctcgcagcaaacatccaacctcacatcactctctaccactgggaccttccacaagctctg
caggacattgggggctgggagaatgataccattgtcggcaaattcagggattatgctgac
ctcatctttagccgtcttggccacaaagtcaaattttggatcaccattaatgaaccgtac
aatgtagccaatataggccatggctatggagcagctgccccagggatcagtttccgacca
ggcactctgccctacatcgtgggtcacagcctgcttaaagctcacgccgaggcctggcat
ctctacaatgacaaatacagggccaaacagcaaggaattatctccatcaccatcaactct
gattggtcagaacccaggaatccatacaagcaggaagacattgatgctgcaaaacgtgtg
gtgcagttctacattggttggtttgcccatcccgtttttaatggagactacagcaacatg
atgaagacaatcattcgagagcgaagtttagctgctaatctgacaacatctcgactgcct
gagttcaccccagctgagatcaagaggattaaaggtacctatgattattttgggttcaac
cattataccaccgtcctggcattccctgtgaactatggaaatctgcagcactacgatgcc
gataggggtacaggaacaattgctgatcgtagctggctggattcaggctcgtcctggctg
aaggtttcaccgtttggattccgcaggatattaaacttcattaaggcagagtatggaaat
ccacctattatcatcacagaaaatggtatctcagagcgggggcctattgacctaaatgat
acccttaggagctactactatgaacaatacatcaaccagctgctgaaagcttacttgcta
gataacgtggatatccgtggctacacagcttggtcactgatggacaaccttgagtgggcc
actggcttttcagagagatttggccttttctatgtcaatcactcagacaccaaattgtca
agagtggctaagaattctgttacccactactctaccatcatcaactgcaacggattccca
gaccccgcattgggaccccatgaatgtttcaacccagcgcctgaag

DBGET integrated database retrieval system