KEGG   Notothenia coriiceps (black rockcod): 104955050
Entry
104955050         CDS       T04920                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00232  Caffeine metabolism
ncc00983  Drug metabolism - other enzymes
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    104955050
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    104955050
Enzymes [BR:ncc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     104955050
SSDB
Motif
Pfam: Acetyltransf_2
Other DBs
NCBI-GeneID: 104955050
NCBI-ProteinID: XP_010780577
LinkDB
Position
Unknown
AA seq 186 aa
DSHLIHKVIVNGKAYIADVAFGVSFQIWEPMELVSGKDQHQEAGVFRVLDKGDKWVLEKT
SRKTKVLNPDFAKSSLVKRQETTAIYCFTLEPREVEHFYEANNTLQTDPKSLFMNKSIVS
LQTATGFRALVGWTYSEVTFKPEEGVDVFDLRNIEDEEKEQVLLEKFDIKLQKKLQLVSN
KTCYSL
NT seq 561 nt   +upstreamnt  +downstreamnt
gatagtcatctcatccacaaggtcatcgtcaatggaaaggcttatatagcagatgtggcc
tttggggtgtctttccagatttgggagcccatggagctcgtctctggaaaggatcagcat
caggaggcgggcgtctttcgagtcttagacaagggggacaagtgggttcttgagaagacg
agcagaaagaccaaggttctcaatccagactttgctaaatctagtcttgtgaagaggcag
gagacaacggcgatatactgctttaccttggagcctcgagaggttgagcatttctacgaa
gcaaacaacacacttcagacagatcctaaatcgctgttcatgaataaatccatcgtgtct
ctgcaaacagcgacaggattcagagcgcttgtgggctggacctacagcgaggtcaccttc
aaaccagaggaaggtgtcgatgtcttcgacctgagaaacatagaagatgaggagaaagag
caagttcttctggagaagttcgatataaagctgcagaagaaactgcagcttgtaagcaac
aaaacctgctactcactctaa

DBGET integrated database retrieval system