KEGG   Notothenia coriiceps (black rockcod): 104955130Help
Entry
104955130         CDS       T04920                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00590  Arachidonic acid metabolism
ncc01100  Metabolic pathways
ncc04370  VEGF signaling pathway
ncc04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104955130 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    104955130 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104955130 (ptgs2)
Enzymes [BR:ncc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     104955130 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 104955130
NCBI-ProteinID: XP_010780661
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MNTFTLAVFFLALGVLVCAGGNPCCSEPCQNKGVCTAQGADNYECDCTRTGYQGHNCTTP
EFLTWIKVSLKPSPNTVHYLLTHFKGFWNIINNISFLRNGIMKYVLTSRSHLIDSPPTFN
ADYGYKSWEAYSNLSYYTRSLPPVPEDCPTPMGVVGKKELPDAKLLAEKLLMRRQFIPDP
QGTSLMFAFFAQHFTHQFFKSDMKKGPAFTLAKGHGVDLSHIYGDALERQHKLRLFKDGK
LKHQILDGEVYPPTVKEVGAEMHYPPHVPESHRFAVGHEAFGLVPGLMMYATIWLREHNR
VCDVLKEVHPDWNDERLFQTTRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFSQQF
QYQNRIASEFNTLYHWHPLMPDTFQIEEKDYSYKQFVFNTSVVTEHGIGNLVESFTNQIA
GRVAGGRNVPGPIMYVAIKSIENSRQMRYQSMNAYRKRFSMKPYTSFEDMTGEKEMAALL
EEFYGHVDAVELYPGLLVEKPRENAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTFG
GSVGFDIINTASLQKLVCDNVRGPCPVASFHVPDVKETGSTIINSSSSHSRGSDINPTVI
LKKRTTEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatttactttagcagttttcttcttggcgctgggtgttcttgtctgcgcaggg
ggtaacccatgttgctcagagccatgccagaacaagggtgtttgcactgcacaaggagca
gataattacgaatgtgattgcacacgaacaggatatcaaggacacaactgcacaacacct
gaattcctcacctggatcaaagtatccctgaagccgtcgcccaacactgttcactacctt
ctcacccactttaagggcttctggaacatcatcaacaacatctcatttctccgaaatggc
atcatgaaatatgtgctgacatctcgatcccacttgattgatagtcctccaactttcaat
gctgattatggatacaaaagctgggaagcctattccaacctttcttattatacacgctcc
ctcccccctgtgccggaggattgcccaacccctatgggagtagtaggtaaaaaggagcta
cctgatgcaaagctattggctgagaagcttctgatgagaagacagtttatcccggacccg
cagggcaccagcctgatgtttgcattcttcgcacagcatttcacacaccagttcttcaaa
tctgatatgaagaaaggacctgcttttacccttgctaaaggtcacggggtggacctcagc
cacatttatggagacgccctggaaaggcaacataagctcagacttttcaaggatggcaag
cttaaacatcagatcctggatggagaggtgtaccccccaacagtaaaggaagtgggagct
gaaatgcactacccacctcatgttcccgagtcgcaccgcttcgctgtgggccacgaggct
ttcggcctggtccccggtctgatgatgtacgccaccatctggctgcgggaacacaaccgg
gtgtgtgacgtgttgaaggaggtccaccctgactggaacgacgagaggctcttccaaacc
acccggctcattctgattggagagaccatcaagattgtgatcgaggactacgtgcagcac
ctgagcggctataacttcaagctcaagtttgaccccgagctgctgttcagccagcaattc
cagtaccagaaccgcattgcgtctgagttcaacaccctgtaccactggcaccccctgatg
cctgacaccttccaaattgaggagaaagactacagctataaacagtttgtcttcaacacc
tccgtagtgaccgagcacggcatcggaaaccttgtggagtcattcaccaatcagattgct
ggacgggttgctggtggccgaaatgttccagggcctattatgtatgtggccattaaatcc
attgaaaatagcagacagatgcgctaccagtctatgaacgcctacaggaaacgattctcc
atgaagccctacacctcttttgaagacatgacaggagagaaagagatggcagcattgctc
gaggagttctacggccacgtcgacgctgtggagctctacccgggtctgctggtggagaaa
cccagggagaacgccatctttggggagaccatggtggagatgggggccccttactcacta
aagggcttaatgggaaaccccatctgctccccggagtactggaagccgagcacattcgga
ggcagcgtgggcttcgacatcatcaacaccgcctcgttgcagaagctggtctgcgataat
gtccggggcccctgtcccgtcgcatcctttcacgtgcccgacgtcaaagaaacggggtcc
acgataattaactcaagctcctcccactcacgcggaagtgatatcaacccgacggtcatc
ttaaaaaaaaggactactgagctctaa

DBGET integrated database retrieval system