KEGG   Notothenia coriiceps (black rockcod): 104955159
Entry
104955159         CDS       T04920                                 

Gene name
sufu
Definition
(RefSeq) suppressor of fused homolog
  KO
K06229  suppressor of fused
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104955159 (sufu)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 104955159
NCBI-ProteinID: XP_010780703
UniProt: A0A6I9P0Z3
LinkDB
Position
Unknown
AA seq 471 aa
MDEVRPTSGAPAHGLVPMFPPGLQAIYGECRRLYPEQANPLQVTAIVKYWLGGPDPLDYI
SMYRSAGSPAQDIQEHWHYVSFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGET
APPTWPAELMQGLARYVFQSENTFCSGDHISWHSPLDNSESRIQHMLLTEDPQMQPVLTP
FGTVSFLQIVGVCTEELQAAQQWNGQGILELMRGVRLAGGPWLITDMRRGETIFDIDPHL
QQERVDQGIETEGSNLSGVSAKCVWDDLSRPPEDEEDSRSICIGSQPRRLSEKDTEQIRE
TLRKGLEFNTKAALPPISSQRPSHDRPQSRKDSLESESSAAIVPHELVRTRQLESVHLKF
NQESGTLLPLCLRGRLLHGRHFTYKSINGDTAITFVSTGVEGAFATEEHPYAAHGPWLQI
LLTEEFVEQMLGDLHELNTREETKLPKEYSWPEKKLKISVLPDSVFDNPLQ
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggatgaggtacggcctaccagtggggctccagcccacggactggtgccgatgtttccc
cctggactgcaggctatctacggggaatgccggagactttaccccgagcaggctaacccg
cttcaagtgaccgccattgtaaaatattggttaggtggtcctgacccgttagactacatc
agtatgtatcgcagtgcgggctctccggctcaggacatccaggagcattggcactatgtc
agctttggactcagtgacttgtacggggataatcgggttcacgaattcacagggacagat
ggacccagtgggtttggttttgagctcacttttagactcaaaagagagacgggagagacg
gcaccaccaacctggccagctgaactcatgcaggggttggctcgctatgtattccagtca
gaaaacacattttgtagtggcgaccatatatcgtggcacagtccactagacaacagtgaa
tctcgtatccagcacatgttgctgacagaggatccacagatgcaacccgttctgactccg
tttggcacagtgagctttctccagattgtgggtgtttgtacggaggagctacaggcggcc
cagcagtggaacggccaaggcatcctggagctgatgagaggagtcagactagctggcggc
ccctggctaatcacagacatgaggagaggggagaccatttttgacattgacccacaccta
caacaggagagggtggatcagggtattgaaacggagggctctaacctgagtggggtcagc
gccaagtgtgtgtgggacgatctgagccgaccgccagaggacgaggaggacagccgatcc
atctgcatcggatcccagccccggaggctctcagaaaaagacacggagcagatcagggag
accctgagaaaaggcctggagtttaacaccaaggcagcactaccgcccatcagcagccag
agaccgagccacgacagacctcagagtcggaaggacagtttggagagcgagagctcagca
gccattgtccctcatgagttggtccgaacacgacagttggagagcgtccatctgaaattc
aaccaggagtcaggcacactgctgccgctctgcctgcggggccggttgctccatgggaga
cacttcacttacaaaagcatcaacggagacacagccatcacatttgtgtctactggagtt
gaaggagcttttgctacagaggagcatccttatgccgctcatggcccctggcttcagata
ttgttgactgaagagtttgtggagcagatgctgggggatttacatgaactgaacactcgt
gaggagacaaagttaccaaaggagtacagttggccagaaaagaagctgaagatctctgtc
ctaccagactctgtgtttgataatccactgcaatga

DBGET integrated database retrieval system