KEGG   Notothenia coriiceps (black rockcod): 104955277Help
Entry
104955277         CDS       T04920                                 

Gene name
f13a1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
Enzymes [BR:ncc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104955277 (f13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core FixG_C
Motif
Other DBs
NCBI-GeneID: 104955277
NCBI-ProteinID: XP_010780864
LinkDB All DBs
Position
Unknown
AA seq 742 aa AA seqDB search
MSDPGATATSSPAPPPPTGPRPKMTSSGRSLVPISTSNSDSTDIPEFEPFGLPGPRGFPP
LTDYLDILDVDMMRLPEENNKQQHHTNLYNSDYLVVRRGQEFEVKITFNRPYKAASDKFA
VEFVIGSSPQFSKGTYIPVFPHNERPSPWEGSITNTSDNTVTMGVTAAATCTVGKYHMYV
AVVTPFGIRRTRKDKSRDLYILFNPWASADAVFLDDEKERDECVMNEMGIIYHGAFDDVA
ERNWNYGQFNFGVLDACLYIMDRSDMPITNRGDPIRVTRKASAMLNSRDDEGVLVGNWSG
DYTYGVAPTSWTGSTDILLTYASGKMPVCYAQCWVYAAVFNTFLRCLGIPSRVVTNFYSA
HDNDGNLKMDIILDENGRIDRSRTKDSIWNYHCWNECYMSRPDLPAGFGGWQVVDATPQE
TSDGMYRCGPASVQAIKHGQICFPFDAAFVFAEVNSDVVFYSRNKDGTMEPVRVNRTHIG
RMVVTKSLGDMTRREITDQYKFPEGSTEERTVLEKAEEYGCKRDKSDLPAADVDLILPTL
EVSVGDDFEINLEFVNRSDERRTVDIYISGSVVFYTGVTTSEFLFRNPTVTIGPNKSVKE
PVTVESKAYMKHLVEQANINFIATGKVQETGQIITAMKVVTLHNPKLTITVSEGGRVSEE
MTATVEFTNPFSFSLEGVYIRMEGPGIMLPKSKYYSLIQGRTSLSWTEYFTPQRAGSSRV
IASLDCPALRQVLGQASISVKP
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatccaggcgccaccgcgacctcctctcccgccccccctcctcccaccggaccc
cgacccaagatgacgagcagcggtcgctctttagttcccatctccacctccaactctgac
tccaccgacatccctgagtttgaaccgtttggtctgccgggtccaagaggattcccccct
ctgaccgactatcttgacatcttggacgtggacatgatgcgactgccggaggagaacaac
aagcagcagcaccacaccaacttgtacaactcggactatctggtggtgcgtcgaggacaa
gagttcgaggtcaagatcaccttcaaccgtccctacaaagctgcctcagacaagttcgct
gtggagtttgtgatcggctccagccctcagttcagcaagggcacctacatccctgtcttt
ccccacaatgagcgtccgagcccctgggagggcagcatcaccaacacctctgacaacacg
gtcactatgggcgtcacggctgctgccacctgcaccgtggggaagtaccacatgtacgtc
gccgtggtgacacccttcggtatccgcaggacccgaaaggacaaaagccgcgacctctac
atcctcttcaatccctgggcctcagctgatgccgtgtttctggatgatgagaaggagagg
gatgagtgtgtgatgaatgaaatggggatcatctaccacggcgcctttgatgacgtcgct
gagagaaactggaactatggacagtttaactttggagtcctggacgcctgtctgtacatc
atggaccggtccgacatgcccatcaccaacagaggagaccccatcagggtgaccaggaag
gcctctgctatgctgaactctcgtgatgacgagggtgtgctcgtggggaactggagcggc
gactacacctacggcgtggcgcccacttcctggaccggcagcaccgacatcctgctcacc
tacgccagcggcaagatgcccgtctgctacgctcagtgctgggtctacgctgcagtcttc
aacaccttcctgcgctgtctgggcatcccgtcgagggtcgtcaccaacttctactccgct
cacgacaacgatggaaacctgaagatggacatcatcctggacgagaacggcagaatcgac
cgcagtcgcaccaaagactctatctggaactatcactgctggaacgagtgctacatgtcc
agacccgacctcccagctggctttggaggctggcaggtggtggatgctacaccacaggag
accagtgatggcatgtacagatgtggccctgcctcagtccaggccatcaaacacgggcag
atctgcttcccatttgatgctgcctttgtgtttgctgaggtcaacagcgatgtggtgttt
tattcccggaataaagatggcaccatggagcctgtcagagtgaaccggacccacataggc
cgcatggtggtgaccaaatctctaggagacatgacccgccgcgaaatcaccgatcagtac
aagttccctgaaggcagtaccgaggagcggaccgtcctggagaaggcggaggagtacggc
tgtaaacgcgataagtccgatcttcccgcggccgacgtggacctgatcctgcccaccctg
gaggtcagcgtgggcgacgacttcgagattaacctggagtttgtgaaccgcagcgacgag
cgccgcaccgtggacatctacatcagcggcagcgtggttttctacaccggagtcaccacc
tccgagttcctgttcaggaatcccaccgtgaccattggcccaaacaaaagtgtgaaggag
ccggtgacagtcgagtcaaaggcctacatgaagcatctggtggaacaggcaaacatcaac
ttcatcgccactgggaaggtccaggagaccgggcagatcatcaccgccatgaaagtcgtc
accctgcacaaccccaaactcaccatcacggtgtcggagggcggcagagtgagtgaggag
atgacggcgaccgtggagttcacaaaccccttctccttcagcctggagggcgtctacatc
cgcatggagggacccgggatcatgctgcccaagtccaaatattacagtctgatccaggga
cgtacttccctctcctggacggagtatttcaccccgcagcgggccggcagcagcagagtg
atcgcctctctggactgtcccgccctcaggcaggtcctcggccaggcgtctatcagcgtg
aagccctga

DBGET integrated database retrieval system