KEGG   Notothenia coriiceps (black rockcod): 104955518
Entry
104955518         CDS       T04920                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04012  ErbB signaling pathway
ncc04068  FoxO signaling pathway
ncc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104955518 (cdkn1b)
   04068 FoxO signaling pathway
    104955518 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104955518 (cdkn1b)
SSDB
Motif
Pfam: CDI Rota_NS35
Other DBs
NCBI-GeneID: 104955518
NCBI-ProteinID: XP_010781157
UniProt: A0A6I9NYX9
LinkDB
Position
Unknown
AA seq 182 aa
MSDVRLSNGSPTLERTDSRVSDHPKPSACRSLFGSLDHEELKRDLKGHLREMEEAATAKW
GFDFSNHTPLSHGRLEWEVVDSRDVPSFYNRQPRREKSVCSAGNNVDLNGNHHCVVVPED
TDRADGQMECTEQCTGLRKRPACHEPSAQNKRSHSSSEEVTCPSLSHSTEKTPRKTSPKR
QT
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactatcaaacgggagcccgacgctggagcggacggactcccgggtg
tcggatcacccgaaaccgtccgcctgcagaagcctcttcggctcgctggatcacgaagag
ttaaagagggatttaaagggacacttgcgggagatggaagaggctgccaccgccaagtgg
ggcttcgacttctctaatcacacgccgctgtctcacggcaggcttgagtgggaggtagtg
gatagcagagacgtgccgagtttctacaaccggcagccgcggagggagaagagcgtctgc
tccgccgggaataatgtggatctaaacgggaaccatcactgtgttgtggtgcccgaagac
acggacagggcggacgggcagatggagtgcacggagcagtgcaccgggctgaggaaaaga
cctgcatgccacgagccctcggcccagaataagaggtcacacagcagctcagaggaggtt
acttgtccaagtctgagccactcgacagaaaaaacacccagaaaaaccagtcccaagagg
caaacgtga

DBGET integrated database retrieval system