KEGG   Notothenia coriiceps (black rockcod): 104955540
Entry
104955540         CDS       T04920                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104955540 (tgfa)
   04012 ErbB signaling pathway
    104955540 (tgfa)
SSDB
Motif
Pfam: Spore_III_AB EGF Laminin_EGF
Other DBs
NCBI-GeneID: 104955540
NCBI-ProteinID: XP_010781186
UniProt: A0A6I9P3Y5
LinkDB
Position
Unknown
AA seq 263 aa
MTRIFWDTIFLISGTFTFTSVILNGSFFTFGAGPSNSTIIEASISIDTNSTAAPNTSTIS
SATTTLTSIAPATTTNTPQVENSLFTFEAGLIDSINIEASITIHTNSTAAPNDTTSSSAT
TNSRNTTTTITRATTTTVHPVKKFVAAAVQSHFDNCPDSHHHFCFHGTCRFLILEETPAC
VCHEGFVGMRCEHADLLAVVATNHRQQTVATVLVLCVIGCVLIMVMCTLLHCWWRQDYRR
QIRAHHHVTEKHGASCHPSESVV
NT seq 792 nt   +upstreamnt  +downstreamnt
atgactcggattttctgggatacaatttttctcataagcggtacttttacttttacttct
gtgatactcaatggttccttctttacatttggagcaggaccgagtaattccacaataatt
gaagccagcatttctatcgatacaaactccactgctgctccgaacacctcaacaatcagc
tctgcaacaacaactctcacttctatcgcccctgctacaacaactaacacgcctcaagtt
gaaaattccctctttacattcgaagcaggactgattgattcgataaacatagaagccagc
attaccatccatacaaattccactgctgctccaaacgacacaacaagcagctctgcaaca
accaacagcagaaacacaactacaactatcacacgtgctacaacaactaccgtccatcca
gttaaaaagtttgtggctgccgctgtccagtctcatttcgataactgtccagactcacat
caccatttctgcttccacggaacatgtcgcttcctgatattagaagaaacacctgcatgt
gtgtgtcacgaaggctttgttgggatgaggtgtgagcatgcagacctgctggctgtcgta
gcaaccaatcacagacagcagaccgttgccacagtgctggtgttgtgtgtgattgggtgt
gtcctgatcatggtgatgtgtacacttttacactgctggtggaggcaggactatcgcagg
cagatccgtgcacatcaccacgtgacagagaagcatggagcatcttgccatccttctgag
agcgtggtttga

DBGET integrated database retrieval system