KEGG   Notothenia coriiceps (black rockcod): 104955766
Entry
104955766         CDS       T04920                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04012  ErbB signaling pathway
ncc04068  FoxO signaling pathway
ncc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104955766
   04068 FoxO signaling pathway
    104955766
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104955766
SSDB
Motif
Pfam: CDI Roughex
Other DBs
NCBI-GeneID: 104955766
NCBI-ProteinID: XP_010781457
UniProt: A0A6I9NZU8
LinkDB
Position
Unknown
AA seq 181 aa
MCNKMSDVRLSTASPTLERVDARQPENARPSVRRNLFGKPDPEELNRHLQSFAQEEVERF
TETYNFDPVNDRPLSPRNFDWEEERDAPEFYTRQPHTRPQREEDLPGHNHQEGAEGRSDQ
PDTLGSRKRRSGASGSCSSECPGKRSHTDEEDDEDQSDSAGSQAVKSSEERPSTEVRTEA
K
NT seq 546 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcagatgttcgcctttctaccgcgagccccacattggagagggtg
gatgcgcggcagccggaaaacgcgagaccctcggtgcgcagaaacctttttggcaaaccg
gacccagaggagctaaacaggcatttacagtcttttgcacaggaagaagtggagcgtttt
acggagacgtataatttcgaccccgtcaacgacagaccgctctccccgcgcaatttcgac
tgggaggaggagcgcgacgcaccggagttttacacccggcagcctcacacgagaccccag
cgagaggaagacctgcccggacacaaccaccaggagggagccgaagggaggtcggatcaa
ccggacacactcggttcgaggaagaggcgttcaggagcttcaggttcctgctccagcgaa
tgtcctggtaaaaggtcgcataccgatgaagaggatgatgaagaccagtcggacagtgca
ggaagtcaggcggtgaaatcctcggaggagagacccagcacggaggttagaacggaggcc
aagtga

DBGET integrated database retrieval system