KEGG   Notothenia coriiceps (black rockcod): 104956154
Entry
104956154         CDS       T04920                                 

Definition
(RefSeq) smoothened homolog
  KO
K06226  smoothened
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104956154
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ncc04030]
    104956154
G protein-coupled receptors [BR:ncc04030]
 Frizzled / Smoothened family
  104956154
SSDB
Motif
Pfam: Frizzled Dicty_CAR
Other DBs
NCBI-GeneID: 104956154
NCBI-ProteinID: XP_010781911
UniProt: A0A6I9P6G7
LinkDB
Position
Unknown
AA seq 189 aa
MRLGEPSSSETLSCVTIFIIVYYSLMSGVIWFVMLTYAWHTSFKALGTTQQPLSGRTSYF
HMVTWSVPFILTVAILAIAEVDGDSVSGICFVGYKNYKYRAGFVLAPIGVVLVVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVFITFGCHFYDFFNQAEW
ERSFREYVL
NT seq 566 nt   +upstreamnt  +downstreamnt
atgcgcctcggggagccctcgtcttcagagacgctgtcctgtgtcaccatcttcatcatt
gtgtactactccctgatgtcgggtgtgatttggttcgtcatgctgacctatgcctggcac
acgtccttcaaagccctgggcaccacccagcagccactgtccggcagaacctcctacttc
cacatggtcacctggtcggtccccttcatcctcactgtggccatcctggctatcgctgag
gtggatggagactcggtgagtgggatctgttttgtaggctacaaaaactacaaataccgc
gctgggtttgtgctggcccccattggagttgtgcttgttgtcggcggttacttcctcatt
cggggtgtcatgactttgttttccattaagagtaaccacccaggactgctgagtgagaaa
gctgccagcaaaatcaacgagacgatgctgaggctgggtatatttggattcctggctttt
ggctttgttttcatcaccttcggctgccacttctacgatttctttaaccaggctgaatgg
gagaggagctttagagaatatgtgct

DBGET integrated database retrieval system