KEGG   Notothenia coriiceps (black rockcod): 104956659
Entry
104956659         CDS       T04920                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00480  Glutathione metabolism
ncc00980  Metabolism of xenobiotics by cytochrome P450
ncc00982  Drug metabolism - cytochrome P450
ncc00983  Drug metabolism - other enzymes
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104956659 (gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104956659 (gsto1)
   00982 Drug metabolism - cytochrome P450
    104956659 (gsto1)
   00983 Drug metabolism - other enzymes
    104956659 (gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ncc02000]
    104956659 (gsto1)
Enzymes [BR:ncc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104956659 (gsto1)
Transporters [BR:ncc02000]
 Other transporters
  Pores ion channels [TC:1]
   104956659 (gsto1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin
Other DBs
NCBI-GeneID: 104956659
NCBI-ProteinID: XP_010782481
LinkDB
Position
Unknown
AA seq 239 aa
MSTEKSFAKGSAAPGPVPDGKIRLYSMRFCPFAQRTRLVLAAKGIKHETMNINLKDKPEW
FLKKNPLGLVPTLENPAGEVVYDSPITCEYLEEVYPEKKLLPPSPFGKAQQKMMLEHFSK
VVPYFYKIPMGRKKGEDVSALEGELKEKFAKLNEDLVNKKTGFFCGDSITMIDYMMWPWF
ERLELMELKHCLGGTPELKKWTERMSEDTAVKACMHSAETYKAFYKTYQEGKPDYDYGL
NT seq 720 nt   +upstreamnt  +downstreamnt
atgtctactgaaaagagtttcgccaaaggaagtgctgcacctggtccagtcccggatggc
aaaatcagactttacagcatgagattctgccctttcgcccaaaggaccagattagtgctg
gctgccaaagggatcaagcatgaaaccatgaacatcaacctgaaggacaaacctgagtgg
tttcttaagaagaatcctctcgggctagtcccaaccctggagaaccctgctggggaggtg
gtatatgattctcccatcacctgcgagtacctggaggaagtttaccctgagaagaagctg
cttcctccctctccttttggtaaagcccaacagaagatgatgctggagcatttttccaag
gtagtaccttacttctacaagatcccaatggggagaaagaagggcgaggatgtctctgca
ctggaaggagaactgaaagagaagtttgccaaattaaatgaggacctagttaacaagaag
accgggttcttttgtggtgactccatcacaatgatcgactacatgatgtggccgtggttt
gagaggctggagcttatggaactcaaacactgccttggtggcacacctgagttgaagaag
tggacagagcgcatgtcagaggacacggcggtcaaagcctgcatgcacagtgcagaaacc
tacaaggccttctacaagacttaccaggaggggaagccggactacgactacggcctgtag

DBGET integrated database retrieval system