KEGG   Notothenia coriiceps (black rockcod): 104956790Help
Entry
104956790         CDS       T04920                                 

Gene name
gck
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00010  Glycolysis / Gluconeogenesis
ncc00052  Galactose metabolism
ncc00500  Starch and sucrose metabolism
ncc00520  Amino sugar and nucleotide sugar metabolism
ncc00524  Neomycin, kanamycin and gentamicin biosynthesis
ncc01100  Metabolic pathways
ncc01200  Carbon metabolism
ncc04910  Insulin signaling pathway
Module
ncc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ncc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104956790 (gck)
   00052 Galactose metabolism
    104956790 (gck)
   00500 Starch and sucrose metabolism
    104956790 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    104956790 (gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104956790 (gck)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104956790 (gck)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     104956790 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 UNC-79
Motif
Other DBs
NCBI-GeneID: 104956790
NCBI-ProteinID: XP_010782633
LinkDB All DBs
Position
Unknown
AA seq 459 aa AA seqDB search
MDKVEEILSDFSLKKEELKEVMKRMQREMDRGLRLETHDEASVKMLPTYVCSTPEGSVCV
LAEVGNFLALDLGGTNFRVMLVKVGEDEERIWKVETKNQMYSIPEDAMTGTAEMLFDYIA
ECMSDFLDRHHLKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNIVGLLRD
AIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGTGCNACYMEEMRTVELVEGE
EGRMCVNTEWGAFGNNGELEEFRLEYDRVVDENSINPGRQLYEKLISGKYMGELVRLVLM
KLVNEDLLFNGEASEQLKTRGSFETCFVSQMESDTGDRKQIYNILSSLGVLPSELDCDIV
RLVCESVSTRSSHMCGAGLAAVINRMRERRSQEALKITVGVDGSVYKLHPWFRVRFHQIV
RDLTPHCDITFIQSEEGSGRGAALISAVACKMAACMLTQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggataaggtagaggagatcctgtcagacttcagtttgaagaaggaagagctaaaagaa
gtcatgaagaggatgcagcgcgagatggaccgaggattgcgtttagagacgcacgatgag
gctagtgtcaaaatgcttccaacatatgtctgctccacccctgaaggatcagtgtgtgtt
ttagcagaagtgggaaatttcctggctctcgacctgggggggaccaacttccgcgtgatg
cttgtgaaggtgggtgaagatgaagagaggatctggaaggtggagaccaagaaccagatg
tactccattcctgaagatgccatgacgggcactgctgaaatgctttttgactacatagca
gagtgtatgtccgactttttggacagacatcatttaaagcacaagaagcttcctctgggt
ttcaccttttcctttccagtaaggcatgaggacattgacaagggtatcctgcttaactgg
accaaaggcttcaaggcttctggagcagaagggaacaacattgttggcttactcagagat
gctatcaagagacgaggggactttgagatggatgtggttgccatggtgaatgacacagta
gccaccatgatttcctgctactatgaggatcgcagctgcgaagttgggatgattgttggc
actggctgtaacgcatgttacatggaggagatgaggactgtggagctggtggaaggggag
gagggccggatgtgtgtgaacacagagtggggtgcattcggaaacaacggggagctggag
gagttcagactggagtacgacagagtggtggatgagaactccattaaccccggacggcag
ctatatgagaagctgatcagtgggaagtatatgggagagctggtcaggcttgttctgatg
aagctggtgaatgaagacctgctgtttaacggtgaggcctcagagcagctgaagacacgt
gggagctttgagacgtgctttgtctcacagatggagagtgacactggggacagaaagcaa
atttacaacatcctgtcctcgctgggtgttctgccgtcagagctggactgtgacattgtg
cgtctggtgtgtgagagcgtctccactcgctcttcacatatgtgcggcgctgggcttgca
gctgtgatcaaccggatgagggaacgacgcagccaagaagccctgaagatcacagtgggg
gttgatggatccgtctacaagctgcacccatggttccgtgtaagattccaccaaattgtc
agggacctcacgcctcactgtgacatcaccttcatccagtcggaggaggggagcggtcgt
ggagccgcccttatctcagcagtggcctgtaagatggctgcctgcatgctgacccagtga

DBGET integrated database retrieval system