KEGG   Notothenia coriiceps (black rockcod): 104956842Help
Entry
104956842         CDS       T04920                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00010  Glycolysis / Gluconeogenesis
ncc00030  Pentose phosphate pathway
ncc00051  Fructose and mannose metabolism
ncc00052  Galactose metabolism
ncc01100  Metabolic pathways
ncc01200  Carbon metabolism
ncc01230  Biosynthesis of amino acids
ncc03018  RNA degradation
Module
ncc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104956842
   00030 Pentose phosphate pathway
    104956842
   00051 Fructose and mannose metabolism
    104956842
   00052 Galactose metabolism
    104956842
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    104956842
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:ncc01009]
    104956842
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:ncc03019]
    104956842
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     104956842
Protein phosphatases and associated proteins [BR:ncc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104956842
Messenger RNA biogenesis [BR:ncc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     104956842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Endonuc-BsobI
Motif
Other DBs
NCBI-GeneID: 104956842
NCBI-ProteinID: XP_010782695
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MSSDLHPNLDPTKMGLGRSIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVYFVHEGYQGL
VDGGNNIRLATWESVSMMLQLGGTVIGSARSKDFRTREGRRKAACNLVKLGITNLCVIGG
DGSLTGADAFRSEWSGLLGDLVTAGSISEAEAKQSSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDAITTTAQSHQRTFILEVMGRHCGYLALVSALSCGADWVFIPEMPPDDG
WEDHLCRRLADQRARGSRLNVIIVAEGAMSRDGQPITSDQIKELVTDRLGFDTRITVLGH
VQRGGTPSAFDRILGSRMGVEAVMALLEATHDTPACVVSLSGNQAVRLPLMECVQVTKDV
TAAMAEGRFEDAIKLRGKSFENNWKTYKLLAHINPPDVKSNINVAIMNIGAPCAGMNAAV
RSAVRMGLIQGHTMLAVHDGFDGLAHGQIEPITWTSVTGWTGKGGSMLGTKRSLPGKMLE
EISQNIAKFNIHALVIIGGFEAFVGGLELVQARAKYEEMCIPMVVIPATVSNNVPGSDFS
IGADTALNTITATCDRIKQSAAGTKRRVFIVETMGGYCGYLATMAGLAAGADAAYIYEDK
FNIKDLELNVEHLVEKMKTTVKRGLILRNENSNANYTTDFIFNLYSEEGKGIFDCRKNVL
GHMQQGGTPTPFDRNFGTKMGAKTVLWLTDKLKECYRHGRIFANTPDSACVLGMRKRALT
FQPLTELKADTDLEHRIPKTQWWLKIRPIMKILAKYDIKLDTSEHTDMEHVINKRGDLGK
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtgatctccatcccaacctggaccccacaaagatggggctcggacgctccatc
gccgtactgacgtcaggaggagatgcacaaggtatgaacgctgctgtgagagccacagtc
agagttggtctctacaccggagcaaaggtctactttgttcatgagggctaccagggcttg
gtggatggaggaaacaacattcgcctcgccacatgggagagtgtgtccatgatgcttcag
ctgggaggaactgtgatcggcagcgcccgcagcaaggacttccgcaccagagagggtcgt
aggaaggccgcttgcaacctggtgaagctgggaatcaccaacctgtgtgtgatcgggggg
gacggcagtctgaccggagccgacgcgttcaggagtgagtggagcgggctgctgggagac
ctcgtcaccgctggttcaatttctgaagcggaagccaagcaatcttcccatctgaacatc
gtgggcatggtgggctccatcgacaacgacttctgtggcaccgacatgaccattggcact
gactccgccctgcaccgcatcatcgaggtggtggacgccatcaccacgaccgctcagagc
caccagaggacatttatcctggaagtgatgggcagacactgtgggtacctggccctggtg
tcggctctgtcctgcggggccgactgggtcttcatcccagagatgcccccagatgatggc
tgggaggaccatctgtgcaggaggctggcagaccaaagggccagaggttctcgcctgaat
gtgatcattgtggctgagggagcgatgtccagagatggccaaccgattacatctgaccag
atcaaggagctggtgactgacaggctcggctttgatacccgcatcactgttctcggacac
gtgcagagaggaggaaccccctccgccttcgacagaattctgggcagcaggatgggtgtg
gaggcggtgatggcactgctggaggccactcacgacactcctgcctgtgtggtcagcctg
tccgggaaccaggcagtcagactgccgctcatggagtgtgtgcaagtgacaaaagatgtt
actgccgccatggctgagggcagatttgaagatgccatcaagctcagaggaaagagtttt
gagaacaactggaagacatacaagctgctggctcacatcaacccccccgatgttaagagc
aacatcaatgtggccatcatgaacatcggcgctccgtgcgctgggatgaacgctgcggtc
cgctcagctgtcaggatgggactcatccagggccacaccatgctggctgtgcatgacgga
ttcgatggtctggctcacggacagattgagcctatcacatggacttcagtgacaggctgg
actggaaaaggaggctcaatgttgggcaccaagagatctctaccaggcaaaatgttggag
gaaatcagccaaaatattgccaagttcaacatccacgctttggttatcatcggtggattt
gaggcctttgtgggaggcctggagctggttcaggccagagcgaagtacgaggagatgtgc
attcccatggtggttatccccgccaccgtctccaacaacgtccccggctctgacttcagc
atcggtgctgacaccgccctcaacaccatcaccgctacctgtgacagaatcaagcagtca
gcagcagggaccaagcgccgcgtgttcatcgtggagacaatgggggggtactgcggctac
ctggccactatggctggtctggctgctggggctgatgccgcctacatctatgaggacaaa
ttcaacattaaagacctggagttgaacgtggagcatcttgtggagaagatgaagacaaca
gtgaagagaggtttgattctcaggaatgagaactctaatgccaattacaccactgacttc
atcttcaacctgtactcagaggagggcaaaggcatctttgactgccgtaagaacgtcctc
ggacacatgcagcagggtggcactccaacacccttcgacagaaactttggcacaaagatg
ggtgccaagactgttctgtggctgacagacaaactcaaggagtgttacagacatggtcgc
atcttcgccaacacaccagactctgcctgcgtgctgggaatgaggaagagagcgctcacc
ttccagcctctgactgaactgaaggcagacacagatcttgagcaccgcatccctaagaca
cagtggtggctgaagatcaggcccatcatgaagatcctggccaagtacgacatcaaacta
gacacatccgaacacaccgacatggagcatgtgatcaacaaaaggggcgatctggggaaa
tag

DBGET integrated database retrieval system