KEGG   Notothenia coriiceps (black rockcod): 104957279
Entry
104957279         CDS       T04920                                 

Gene name
arrb2
Definition
(RefSeq) beta-arrestin-2
  KO
K04439  beta-arrestin
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04144  Endocytosis
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104957279 (arrb2)
   04340 Hedgehog signaling pathway
    104957279 (arrb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104957279 (arrb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104957279 (arrb2)
Membrane trafficking [BR:ncc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    104957279 (arrb2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C LDB19
Other DBs
NCBI-GeneID: 104957279
NCBI-ProteinID: XP_010783198
UniProt: A0A6I9P8K3
LinkDB
Position
Unknown
AA seq 339 aa
MSFSNPNPPSFYRVFKKSSPNCKITVYLGKRDFVDHLEHVDPVDGVLLVDQEYLKDRKVF
VTLTCAFRYGREDLDVLGLSFRKDLYVSTLQVFPPLEDKKTPLSRLQERLLKKLGQQAHP
FHFTIPQKLPCSVTLQPGAEDTGKACGVDYELRAFCAKTAEEKIHQRNSVQLLIRKVQYA
PEKPGPQPMVETSRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKSVKRVKIS
VRQYADICLFSTAQYKCPVAHVEADHQVSPSSTSCQVYTLTPTLGTNREKRGLALDGKLK
HEDTNLASSTIVKEGTNKEMMGILVSYRVKIKLVVSLGG
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgagtttttctaaccctaaccctccttctttctacagagtctttaagaaatccagcccc
aactgcaagatcacagtttatctagggaagcgagactttgttgatcacttagaacatgta
gatccagttgatggagtgcttcttgtagaccaagagtatctgaaagaccgaaaagtgttt
gtgactctgacctgtgcgtttcgttatggtcgggaggatctggacgtcctgggcctttcc
ttccggaaggatctgtacgtcagcacactgcaggtgttcccccctctggaggacaagaag
acccctctgagccgcctgcaggagcggctgctgaagaagctggggcagcaggcccacccc
ttccacttcactatcccccagaagctgccttgctcagtaaccctccagccaggcgcagag
gacactgggaaggcatgtggcgtggactatgagctcagagcattctgtgctaagactgca
gaggagaagatccaccaaaggaattctgttcaactgttgatccggaaggttcaatatgcc
ccggagaagccgggtcctcagccaatggtggagaccagtcgcagcttcctgatgtccgac
agatctctacacctagaggcctcactggataaggagctgtactaccatggtgagcccatc
agtgtcaacgtccatgtcaccaacaactccaccaagagtgtgaagagggtgaagatatct
gttcgtcagtatgccgacatctgtctgttctccacggctcagtataagtgtccagttgcc
catgttgaagcagatcaccaggtttctcccagctccacctcctgccaggtctacactctg
acccccacgctggggaccaacagggaaaagagaggcctggccctggatggaaagctaaag
catgaagacaccaacctggcctccagcaccatagtaaaagaagggaccaacaaggagatg
atggggatcctggtttcctacagagtcaaaatcaaactggtggtgtctcttggagggtag

DBGET integrated database retrieval system