KEGG   Notothenia coriiceps (black rockcod): 104957554Help
Entry
104957554         CDS       T04920                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00562  Inositol phosphate metabolism
ncc01100  Metabolic pathways
ncc04068  FoxO signaling pathway
ncc04070  Phosphatidylinositol signaling system
ncc04115  p53 signaling pathway
ncc04140  Autophagy - animal
ncc04150  mTOR signaling pathway
ncc04218  Cellular senescence
ncc04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104957554
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104957554
   04070 Phosphatidylinositol signaling system
    104957554
   04150 mTOR signaling pathway
    104957554
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104957554
  09143 Cell growth and death
   04115 p53 signaling pathway
    104957554
   04218 Cellular senescence
    104957554
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104957554
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ncc01009]
    104957554
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104957554
    3.1.3.48  protein-tyrosine-phosphatase
     104957554
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     104957554
Protein phosphatases and associated proteins [BR:ncc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    104957554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DSPn
Motif
Other DBs
NCBI-GeneID: 104957554
NCBI-ProteinID: XP_010783501
LinkDB All DBs
Position
Unknown
AA seq 133 aa AA seqDB search
MGFPADRLEGVYRNNIDDVVRFLDLKHKNHYKIYNLCAERHYDTSKFNCRVAQYPFEDHN
PPQLELIRPFCEDLDQWLSEDEQHVAAIHCKAGKGRTGVMICAYLLHRGKFSEAQEALDF
YGEVRTRDKKVRR
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgggtttccccgcggaccgcctggagggcgtctaccggaacaacatcgacgacgtggtg
cggttcttagacctgaagcacaagaatcactacaagatctacaacctgtgtgcggagcga
cactacgacacgtcaaagttcaactgtcgagtggcccagtacccgttcgaggaccacaac
ccgccccagctggagctgatcaggcccttctgcgaggacctggaccagtggctgagcgag
gacgagcagcacgtcgccgccatccactgcaaggccggaaagggtcgcaccggggtcatg
atctgcgcctacctgctgcaccgagggaagttcagcgaggcgcaggaggcactcgacttc
tacggggaggtgcgcaccagagacaagaaggtaaggagataa

DBGET integrated database retrieval system