KEGG   Notothenia coriiceps (black rockcod): 104957630Help
Entry
104957630         CDS       T04920                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD2-like
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104957630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104957630
Enzymes [BR:ncc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104957630
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104957630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 104957630
NCBI-ProteinID: XP_010783577
LinkDB All DBs
Position
Unknown
AA seq 1506 aa AA seqDB search
MEEPCDLKHFVKEEGSNASVKVEGLSKAALIKSLSPRVMLSNHLLPKGTKMKVNLEDQGR
QKVSFGFAPTKKPLQSPFFLPASPDKSVDEPNAALSQSTSEVEGQNTDIEQTEQNQTPMV
QQSIAEIHSPTPVAAATKLKTDLPKMHFKKQILSVSVTEENPTTVVPEEPNSPELQVLQK
PTSEPEFPTPQPQNVLSLCPSENNPIQAPDKRVTPTLKKPAAPSGKDGESSSCAEQVIKV
EKTKTRSHSDSAHPGSESDGDSGQMSSSRKSVDSKSKANSDSRSKEIKKSSSSSHVEEKE
KSYSRRSENNERSSSYSKSERDPRHTSSRSSRSDKDRKRSRSRSRSKSKGSRTSSSHSRS
ERSRGDRGSRSERSYYHDSDRRSHRSSPRRERRRSRSRTDRTRDSSDSEDDHRKTRTRTS
DSSKLSSHSTSHKDSKSSSYSKSEKVSKSSDFPQSSEFDKRTKSSKSERTSKRLSDSDSQ
LKCSPDLDSSYHKSSTHHKSETNSKSSSSSMHTNSQTCEKRQKSSSNDSEADHKGKSKAS
EKMSGREDKCKNYPMKTSRPDSKQMTPSRFSGKTSGHDKQSDYIFHSPGKALSNTNTTEA
FSRSEKEKNDSLKGGNECSGQNVKEMVSCPDEKSQESSLKRSKETKSSLDVDPSAITPSE
NLKHAALENVTNVKDSPSSNNRPHLNSDAAVLNSCSSNDSILCNQDKNIVDCLPGPKSLE
ISDVPVTHDVQQNTKPVIVKDLTAGKLPDTNLLLKSELSCLESEDQLTIEQQNMDTVQKN
SSASKKSRWDIVGQNTSESDNLEWSLCAESTPSVKKVISVKQIEVSKDNNQQDSDINKHT
RQGAETHSKLDKQTKNSRQEVGSDSPPISDKYKDQSETSQASTSIDHCDLKLRVCQKFKT
DEPMHVNDASQVDKAAKMQSWNGDGHEDKSRGSTPKNKLSNRTLLNQDGLGGQSEVSDSD
NSEYDSDCGEAIKRLHSVVVVPKNSSLIGDAQDTGASPSNLLNNSQLQNANINEVPIQGT
QQRQGAAFSILATSGPCDGLNDSSQSSMLCQSQSNMIDSTSHSEGSSSIGAQRYMAGQIV
AHGSATDPAHSLDNSRQREQGHTQHNVSSRGERMQSNFQPDADNINDKNGLSLGWEFSHP
EQPSTTYQLPDSSHGPHLANTKLAETSAMGQEQKQSNATWNHQSPNTQTIRQPYLHVHEH
YPDPAGEIHPDSLTNDQDDFSEDKLSNLGKTAVECAGLQGHEISSNSRGSALPDAPREDN
LRPHRGRGPPKKRRPEIESDSDNEAEAGPAGKRERPESADVSKETHVRAEVQRPLLNLRD
FQDSSKWREFSRSKKMPPYFDLIEENLYLTERKKSKSHRDIKRMQCECPVLPREERSRGV
LACGEDCLNRLLMIECSSRCLNGHYCSNRRFQMKQHADFEVILTEDKGWGLRAAKDLIEN
TFVLEYCGEVLDHKEFKTRVKEYARNKNIHYYFMALKNNEIIDATLKGNCSRFMNHSCEP
NCETQK
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaccttgtgacctcaagcacttcgtaaaagaggaggggagtaatgcctcggtg
aaggtggagggcctatccaaggcagctctaatcaagagcctgtctcccagagtcatgcta
tccaaccatctcctgcctaaagggaccaagatgaaggtcaaccttgaggatcagggtcgt
cagaaagtgtccttcggctttgcaccgaccaagaagccactgcagagcccattcttcctc
cctgccagtcctgacaagtctgttgatgagcccaacgctgccttgtcacagtcaacctca
gaagtagaagggcaaaatacagacattgagcaaactgagcagaaccagacccccatggtg
caacaatcaatagcggagatacattctccaacaccagtcgctgcagccactaaactgaaa
acggacctgccgaagatgcatttcaagaagcaaattctcagtgtctctgtgactgaagag
aatccaacaactgttgtgccagaggagccaaactctcctgaattgcaggttttgcaaaaa
ccaacaagtgaacctgaatttccaacgcctcagcctcagaatgtcctcagtctctgcccg
tctgaaaataatcccattcaggcccctgataaaagggttacacctaccctcaagaagcca
gctgccccctcaggaaaagatggagagagttccagctgtgctgagcaggttattaaggta
gagaaaacaaaaaccaggtcccactctgatagtgctcaccctggctctgaatctgatgga
gattcaggccagatgtcttctagtcgcaaatcagttgactccaaaagtaaagcaaactct
gacagcagaagcaaagagataaaaaagtcttcctcaagttcccatgtggaggaaaaagaa
aaaagttactctaggcggtcagagaataatgaaaggtcttctagttactccaaatcagaa
cgtgatccaagacacacatcctcacgctcatctcgatccgataaagatcgcaaaaggtcc
aggtctagatcacgttctaaatcaaaagggtcccggacaagttcatctcactccaggtca
gagagatccagaggcgacagagggtcacgctccgaaaggtcatactaccatgactctgat
cggagatcacaccggagttctccacgcagagagagaagacgttctcgctctcgcactgac
agaactcgggacagttctgactctgaggatgaccacaggaagacaagaacaaggactagt
gactccagtaaattgtccagccattcaacctcacataaagactcaaaatcatcttcctac
tcaaagtctgagaaggtttctaaatcttcagattttcctcagtcttcagaatttgataaa
agaacaaaatcgtcgaagtctgaaaggacctcaaagcgactatcggactctgattcccag
ctcaagtgctctccggatctggactctagttaccataaatctagcacccatcacaaatca
gagaccaacagcaaatcctcttcttccagcatgcatacaaactctcaaacatgtgaaaaa
cggcaaaaaagcagctccaatgactctgaagcagatcataagggaaaatcaaaggcatct
gaaaaaatgtctggtcgggaagacaaatgtaaaaactacccgatgaaaaccagtaggcca
gactcaaagcagatgaccccttctagattttctgggaaaaccagtggacacgataaacaa
tcagattacatatttcacagccctggcaaagcactgtcaaacacaaacaccacagaggct
ttttctcggagtgagaaagaaaaaaacgattccctaaaaggtggtaatgaatgtagtggt
cagaatgttaaggagatggtctcatgccccgatgaaaaatcgcaagaatcctcattgaag
agatcaaaagaaacaaaatcaagtcttgatgtagacccctcagctataaccccaagtgaa
aacctaaagcatgccgccctggaaaatgtgaccaatgtgaaggatagcccttcttctaat
aatcgaccacatttgaactctgatgcagctgtcttaaattcatgcagtagtaatgatagc
atactgtgcaaccaggacaagaacattgttgactgtttaccagggccaaagtccttagaa
atatcagatgtacccgtcacccatgatgtccagcagaacactaaaccagtgatcgttaaa
gatttgacagccggcaagctgcctgacacaaatttgttgctcaaatctgaattatcgtgt
cttgaatctgaggatcagctgacaattgaacagcaaaatatggatactgttcaaaagaac
agcagtgcgtcaaaaaagtcccggtgggatatagttgggcagaacacctcagagagtgat
aatttagagtggtcactttgtgcagagagtacgccttctgttaaaaaagtgatttctgtc
aaacaaattgaagtttctaaagacaataaccaacaagactctgatattaacaaacatact
cggcaaggagctgaaacacattccaaactggataagcagactaagaactctcggcaggaa
gttggctcagacagcccaccgatatccgataaatacaaagaccaaagtgagacttcacag
gcaagcaccagcattgaccactgtgacttaaagctgagagtttgtcaaaaattcaaaaca
gatgagcctatgcatgtaaatgatgcatcacaggtcgacaaagctgcaaagatgcagagt
tggaatggcgatggtcatgaagacaaatccaggggcagcacccccaagaacaaattgagt
aatagaacattacttaatcaggacggattaggaggacagagtgaggtcagtgatagtgac
aactctgagtatgactccgattgcggcgaggccataaaacgattgcactctgtggtggta
gtgccaaagaattcttcactaataggagatgcacaggatacgggagcttctccaagcaat
ctattgaacaattcccaactacagaacgcaaatatcaacgaagtcccgattcaaggtaca
caacaaaggcagggggctgctttctcgatcctggcgacaagtggtccttgtgatggtcta
aatgattcatcccaaagtagcatgttgtgtcaatcccagagtaatatgattgatagcacg
agtcactcagagggttccagctccatcggtgcacagcgttacatggcgggtcaaattgtt
gcccatggaagtgccacagaccctgcccacagtcttgataattccaggcagcgtgagcaa
gggcacacacagcataatgtaagcagcagaggtgaaaggatgcagtcaaatttccaacct
gatgctgacaatatcaatgataagaatggactcagcctgggttgggaattttcacatcca
gaacagcctagtactacataccagctgcctgatagcagtcatgggccacacctagcaaac
actaaactggctgaaacctctgccatgggacaggagcagaagcagagtaatgccacctgg
aatcatcaatccccaaacacacagactatcagacaaccctacctccatgtgcatgagcat
tatccagaccctgcaggtgaaatccatcctgattccctaactaatgaccaggacgacttc
agtgaggataaactgtctaacctcggtaaaacagctgttgaatgtgctggactacaaggg
cacgaaataagcagcaacagcaggggctctgctttgccagacgcccctagagaagacaat
ttaagaccccacagaggaaggggccctcccaagaaaaggcggccagagatcgagtctgat
tcagacaatgaagcagaagctgggcctgcaggcaagagggagcgtccagaaagtgctgac
gtctctaaagaaactcatgtcagagctgaggtgcagcgtcccttgctcaatttgcgagac
tttcaagactccagtaaatggagagagttttccaggtctaagaagatgcccccctacttt
gacttgattgaggagaacctgtacctgacagaaagaaagaaaagcaaatcccatcgagat
atcaagagaatgcaatgcgagtgcccagtgctgcccagagaggagcgctccagaggagta
ttggcatgcggggaagactgtttgaatcggctgctcatgattgagtgctcctcacggtgt
ctgaatggacactactgctctaatagacgctttcagatgaaacaacatgcagacttcgag
gtcatcctcacagaagataagggctggggtctacgggcagctaaggacttgattgaaaac
acctttgtgctggaatactgcggggaggttttggaccacaaggagttcaaaactagggtg
aaagaatatgctcgcaataagaacatccactactatttcatggctctaaagaataatgag
atcattgatgcaacgctgaaagggaactgctcccgttttatgaaccatagctgtgaaccc
aactgtgagacccaaaag

DBGET integrated database retrieval system