Notothenia coriiceps (black rockcod): 104957668 Help Entry 104957668         CDS       T04920                                  Definition (RefSeq) apoptosis regulator Bcl-2-like   KO K02161   apoptosis regulator Bcl-2 Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc04115   p53 signaling pathway ncc04140   Autophagy - animal ncc04141   Protein processing in endoplasmic reticulum ncc04210   Apoptosis ncc04217   Necroptosis ncc04261   Adrenergic signaling in cardiomyocytes ncc04340   Hedgehog signaling pathway ncc04510   Focal adhesion ncc04621   NOD-like receptor signaling pathway ncc05132   Salmonella infection ncc05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ncc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104957668  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     104957668  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104957668   09143 Cell growth and death    04210 Apoptosis     104957668    04217 Necroptosis     104957668    04115 p53 signaling pathway     104957668   09144 Cellular community - eukaryotes    04510 Focal adhesion     104957668  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104957668   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     104957668  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104957668   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     104957668  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ncc01009]     104957668 Protein phosphatases and associated proteins [BR:ncc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      104957668 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Glyco_hydro_64 Motif Other DBs NCBI-GeneID:  104957668 NCBI-ProteinID:  XP_010783626 UniProt:  A0A6I9PC72 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MANECNRNIVEKYICHKLSKRGFAFGFDDVRDEEADNNGSIVVPAPTLVRRCREASTGPD SESTPQLCRRIPQPDPAVEIHRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFSEV IDELFRDGVNWGRIIAFFEFGGTVCVECASKQEMTSQVDNIAEWMTEYLNGPLSSWIQDN GGWMCPLRTTAPTLDMFGLTYELL NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcgaacgagtgtaatcgcaacattgtggagaagtatatctgccataaactctcaaaa cggggcttcgcgtttggcttcgatgatgtccgggatgaagaggctgataataatgggtcg atagtggtccctgcaccgactttggtccgccggtgccgtgaagccagcaccgggcctgac agcgagagcaccccccagctgtgcagacggatcccccagcccgacccggccgtcgagatc cacagagtcctgcgggaggctggggacgaacttgagagactgtatcagccggacttcacg gagatgtctcggcagctctatctcacctccaccacggcgcagaggagattctccgaggtg atagacgaactgttccgggacggggtgaactggggccggattatcgctttcttcgagttc gggggcacggtgtgtgtggagtgcgcctccaagcaggagatgacatcgcaggtggacaac atcgcggagtggatgacagagtatttaaacggacctctgagcagctggatacaagataac gggggatggatgtgcccattacgcaccacagcgccaacgttggacatgttcggcctcact tatgagctgctctga

DBGET integrated database retrieval system