KEGG   Notothenia coriiceps (black rockcod): 104957668
Entry
104957668         CDS       T04920                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04115  p53 signaling pathway
ncc04140  Autophagy - animal
ncc04141  Protein processing in endoplasmic reticulum
ncc04210  Apoptosis
ncc04217  Necroptosis
ncc04261  Adrenergic signaling in cardiomyocytes
ncc04340  Hedgehog signaling pathway
ncc04510  Focal adhesion
ncc04621  NOD-like receptor signaling pathway
ncc05132  Salmonella infection
ncc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104957668
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104957668
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104957668
  09143 Cell growth and death
   04210 Apoptosis
    104957668
   04217 Necroptosis
    104957668
   04115 p53 signaling pathway
    104957668
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104957668
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104957668
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104957668
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104957668
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104957668
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ncc01009]
    104957668
Protein phosphatases and associated proteins [BR:ncc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104957668
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 Glyco_hydro_64
Other DBs
NCBI-GeneID: 104957668
NCBI-ProteinID: XP_010783626
UniProt: A0A6I9PC72
LinkDB
Position
Unknown
AA seq 204 aa
MANECNRNIVEKYICHKLSKRGFAFGFDDVRDEEADNNGSIVVPAPTLVRRCREASTGPD
SESTPQLCRRIPQPDPAVEIHRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFSEV
IDELFRDGVNWGRIIAFFEFGGTVCVECASKQEMTSQVDNIAEWMTEYLNGPLSSWIQDN
GGWMCPLRTTAPTLDMFGLTYELL
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcgaacgagtgtaatcgcaacattgtggagaagtatatctgccataaactctcaaaa
cggggcttcgcgtttggcttcgatgatgtccgggatgaagaggctgataataatgggtcg
atagtggtccctgcaccgactttggtccgccggtgccgtgaagccagcaccgggcctgac
agcgagagcaccccccagctgtgcagacggatcccccagcccgacccggccgtcgagatc
cacagagtcctgcgggaggctggggacgaacttgagagactgtatcagccggacttcacg
gagatgtctcggcagctctatctcacctccaccacggcgcagaggagattctccgaggtg
atagacgaactgttccgggacggggtgaactggggccggattatcgctttcttcgagttc
gggggcacggtgtgtgtggagtgcgcctccaagcaggagatgacatcgcaggtggacaac
atcgcggagtggatgacagagtatttaaacggacctctgagcagctggatacaagataac
gggggatggatgtgcccattacgcaccacagcgccaacgttggacatgttcggcctcact
tatgagctgctctga

DBGET integrated database retrieval system