KEGG   Notothenia coriiceps (black rockcod): 104958296Help
Entry
104958296         CDS       T04920                                 

Gene name
sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00040  Pentose and glucuronate interconversions
ncc00051  Fructose and mannose metabolism
ncc01100  Metabolic pathways
Module
ncc_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104958296 (sord)
   00051 Fructose and mannose metabolism
    104958296 (sord)
Enzymes [BR:ncc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     104958296 (sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2 Methyltransf_25 Pyr_redox_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 104958296
NCBI-ProteinID: XP_010784317
LinkDB All DBs
Position
Unknown
AA seq 354 aa AA seqDB search
MAGENLSVVLHAKGDLRLENRPIPEPGPNEVLLQMHSVGICGSDVHYWQNGRIGDFVLTK
PMVLGHEAAGRVMKVGSEVKHLKVGDRVAIEPGVPREMDEFFKNGRYNLSPTIFFCATPP
DDGNLCQYYKHSANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGTTVLICGAGPI
GLVCLLVAKAMGASQVVITDLAPERLTMAKELGADFQLTVKRGDAPRQLAESVEEKLGTQ
PHVSIECSGVESSIQTAIYATRPGGVVTLVGLGAEMANIPLIHAAVREVDIRGVFRYCNT
WPRAIAMLASGKVNVKPLVTHRFPLEQAVQAFETSRQGLGIKVMLKCDQNDQKP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggaaaatctgtcggtcgtgctgcacgccaagggagacctccggctggaaaat
cgccctatcccagagccagggcctaatgaggttttgctgcagatgcactctgtaggaatc
tgtggatcagatgtccactactggcagaacggccgaatcggggactttgtcctcaccaaa
ccgatggtgttgggacacgaggcagcagggcgtgtgatgaaggtcggatcagaagtcaag
catcttaaagtaggtgacagagtagccattgagccaggcgtgccccgcgagatggacgag
ttttttaaaaacggaagatataacttgtctcctaccatcttcttctgcgccacacctcct
gatgatggcaatctgtgccaatactacaagcacagtgccaacttctgctacaagttgcct
gataacgtgacatttgaggagggagctctaatagaacctctgtctgtggggatccatgcc
tgtcgcagagccggtgtaaccctgggcaccaccgtgctcatctgtggtgcagggcctatt
gggttggtctgcctgctagtggccaaggcgatgggggcctcgcaggtcgtcatcacagat
ctggcccctgagcgtctgaccatggccaaagagttgggagcagacttccagctgacggtg
aagagaggagacgctccccggcagctcgcagagagcgtcgaggagaagctgggcactcag
ccgcacgtttctattgaatgctctggagtggagagcagcattcaaaccgccatctatgcc
acgcgaccaggtggagtggtgacgctggtgggtctcggcgctgagatggccaatattcct
ctgatccatgctgctgtgagagaagtggacatcagaggagttttccgctactgcaacacc
tggccgagggcaatagccatgttggcgtcaggtaaagtgaatgtgaagcccctggtgaca
caccgcttccccctggagcaggcggtgcaggccttcgagacctcacgtcagggtctcggg
ataaaggtcatgttaaagtgtgaccagaacgaccagaagccctga

DBGET integrated database retrieval system