KEGG   Notothenia coriiceps (black rockcod): 104961958
Entry
104961958         CDS       T04920                                 

Gene name
evc2
Definition
(RefSeq) limbin
  KO
K19608  ellis van creveld syndrome protein 2
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104961958 (evc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104961958 (evc2)
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    104961958 (evc2)
SSDB
Motif
Pfam: EVC2_like DUF1344 AbiEi_3
Other DBs
NCBI-GeneID: 104961958
NCBI-ProteinID: XP_010788631
UniProt: A0A6I9PTD6
LinkDB
Position
Unknown
AA seq 1259 aa
MEINGRLVPSAEGPLSSSASSGLWGRPLYTPLSYLSKILPLRNRRSTLTRYNLGLTLPQI
QSVAPPSSYEVKFHKCAQVKLDADPPQLTFFLLVDNKDGTDLSQVTIRDSIFGIVPLKSE
GRVVERGYQEFSIDSLSAGSKVVVNYTAHIRSHKTEVLDLPAFLTFSNVSQNDVSMFGPI
RANLTLRVNSTDRIYLNHGVHFAGFVVGFFVTLVLLSLGFLVMNLIGLRSRLNLLRQRRN
RRDSVPEYAHCNMSETIKDEAAFEDKMVDTMVLEDPQNMYQALENLEMSTLLHATKNLEA
TRIQIYKDVMSSLLGDLRSRGHASAQAQQRLLSVLHGQMLGMEGRLKEERGARLAALNGR
CNLESREEMEAEHRREAAEKNQAELLCQHADQQELLHCSVLLEKLHKLSQSQLQRILLVR
HEEASGRLQRQIIEWRRVELHKIFSEELEEATRMGELEKSTAKSLQHDYFACQDQLEEML
DVVLANHRFVLAERNAQRRFLVHSLHSLNSLISDSFSSTSSNLDRWFTHIRRGSLMSAEQ
IDQLQEKTQKELVMVRQRLDESLSQETGAMRCGLIKKRRELISDMLRVHKQRQKDLSGLS
KGLEGRIDVAQHLHCWRNLLTAHSLELAELINNLDEEAAADIRKVTMRVIQGAITELKAI
QPSAAQALLTLLPPGGQRSLLQLDPEPAGPGIAQGPGASALPQGQERLHQEGKAALRTLS
CSREALRGAMERELQEQRELRARCRAFFSCLCSSQLTLSEDDRLRMKLEFQKCLSVMDRC
LVLPHAVSRTKLHNALAAWRKEGEQQMTNMQSKGKTNDARPKTDTSDLLLFQRRLEDRIQ
LCEKEKETERGLMDGVTEEMRKEREDDLRSQGDSLAMQMATIHYQKAERRTKVLETSRAM
LTLHSLLIQQLRDRKSLERQDMAQSINNHCMGLEEAEQQLQKEVKVLDGLQMSPSRVPTQ
REDPDEGEGESEEERMFQVQRDCRMTFILQGALYKSDQVLALLAERLQEMTGNNQAMEDL
KEQMELRRLYANCDQDLEFASGLVRQSQVSAEVLLEALRLLLPTLPESELLSITDALCPK
QHPGSSSAEQEHSGCAGGVNRVLPVKLREEVVHTNMPTMPSCTVERERLLEKRQRLMEKL
LPRSPLLAPRDVAPLLVGEEGKEDTRTKAQRPIDKSTVTENTVSKPLNDTAKETLQSTAE
EDMMPASASSVLGVHATGERLFVFRDPPEPCDIVGAPKRKKKRNFLNLKKGSVAPTQLP
NT seq 3780 nt   +upstreamnt  +downstreamnt
atggaaatcaatggacgcttggtgccttctgcagaggggccgctctcttcttcagcgtcc
tctggtctatggggacggcctctttacacgccactctcctacctgtcaaagattttgccc
ctcaggaaccgcagaagcacactcaccagatataacttgggcctcactctgcctcagatt
cagagtgtggcacctccatcctcatatgaggtcaagtttcacaagtgtgcacaggtgaag
ctggacgctgaccctcctcagctgactttcttcctgctggttgacaacaaggatggcacc
gacctgtctcaggtgactattcgggactccatctttggaatagtgcccctaaaatctgaa
ggcagggtggtggaaagaggctaccaggagttttccattgattcactgtctgctggatcc
aaagttgttgtcaactataccgctcacataaggagtcataagactgaagtcctggacctt
ccagcttttctcaccttctccaacgtctcacagaatgatgtcagtatgtttggtccaata
agagctaatctaacgttgagagtgaattccaccgacaggatttatcttaaccatggggtc
cattttgctggatttgttgttgggttctttgtcacgctggtgctgctgtcgctagggttt
ctggtcatgaacctgatcggtctcagatccaggctgaaccttctccggcaaaggagaaac
aggcgtgattctgtcccagagtatgcacactgcaacatgagtgagaccataaaagatgag
gccgcatttgaagacaagatggtggacacgatggtgctggaagatccccagaacatgtac
caggctttggagaaccttgaaatgtccacgctgctgcatgccaccaaaaacctggaggcc
acccggattcagatctataaggatgtgatgtcttccctgctgggcgacctgcgttcccgg
ggccatgccagcgcccaggcccagcagaggctcctgagtgtgctccacggacagatgctg
ggtatggagggccggctgaaggaggagcgaggggcccgcctggcagctctgaatggccgg
tgtaacctggagagtcgggaagaaatggaagcagagcatcgaagagaggctgctgagaag
aaccaggccgagctgctgtgtcaacatgcagaccaacaggagcttctgcactgcagtgtc
ctcctggagaagctgcacaagctgagtcagagtcagctccagcgcatcctgttggtccgt
catgaggaagcctcggggaggctccagaggcagatcatcgagtggcgccgggtggagctg
cacaagattttctcagaggaactggaggaggccaccaggatgggggagctggagaagagc
acggccaagagtcttcagcacgattacttcgcctgtcaagatcagcttgaggagatgctg
gatgtggtccttgccaaccaccgctttgtgctcgctgaacgcaacgcacagaggaggttc
ttggtgcacagccttcacagcctcaacagcctgatttctgacagcttctccagcacctcc
agcaacctggaccgctggttcactcacatcaggagagggagcctcatgtctgccgagcag
atcgatcagctgcaggaaaaaacacagaaagagctggtgatggtgaggcagagactggat
gagtctctgagccaagagacgggggccatgcgctgtggactgatcaagaagaggcgggag
ctcatctctgacatgctccgggtccacaaacagagacagaaggacctgtcggggctgtcc
aagggtctggagggacggatagatgtagctcagcacctgcactgttggaggaacttacta
acagctcacagtttggagctagctgagctcatcaacaacctggatgaagaggctgctgca
gacatccgcaaggtgaccatgcgtgtgatccagggtgccataacagaactcaaagccatc
cagccctcggcagcccaggccctgctgacgctcctgcctccagggggccagcgctccctg
ctgcagctggacccggagccggcgggaccagggattgctcagggcccaggggcgagcgct
ctcccccagggccaggagaggctgcaccaggaaggaaaggcagcgctgcgcaccctcagc
tgcagcagggaggctctgaggggagccatggagagagagctgcaggagcagagagagctc
cgggcgcgctgcagagctttcttcagttgtttgtgttcgtcccagctgactctgtctgaa
gatgaccggctcaggatgaaactagagtttcagaagtgtctgtccgtgatggaccgctgc
ctggtgctgccccacgccgtctccagaaccaaacttcacaacgctctagcagcttggaga
aaggagggcgagcaacaaatgacaaatatgcaatccaaggggaaaaccaacgatgccaga
ccaaaaacagacacctctgacctgctgcttttccagagaaggctggaggacaggatccaa
ctgtgtgagaaggagaaggagacagagagaggcctcatggatggggtgacggaggagatg
cgtaaagagagagaggatgacctgcgctctcagggcgacagcttggcgatgcagatggct
accatccactaccagaaggctgagcggaggaccaaggtcctggaaacctccagagcaatg
ctcactctgcacagcctgctgatacagcagctcagagacaggaagagcctggagagacaa
gacatggcccagagtataaacaaccactgcatgggcctggaggaagcagaacagcagctt
caaaaggaagtaaaggtgctggacggcctgcaaatgtctccctccagagtcccaacgcag
agagaagaccctgatgagggagagggggaaagtgaggaggagagaatgtttcaagtgcag
cgggattgcaggatgacgttcatcctccagggggcgctgtacaaaagcgatcaggtcctc
gcgctgttggctgagagattgcaggaaatgactggcaacaaccaagccatggaagattta
aaagagcaaatggagctcaggagactttatgcaaactgtgatcaggatctggagtttgcg
tcggggctggttcggcagagtcaggtgtctgcggaggttctcctggaggccctgcgcctc
ctcctgcccaccctgcctgagagcgaactcctctccatcaccgacgccctctgccccaaa
cagcacccgggctcatcttctgcagagcaggagcactcggggtgtgccgggggggtgaac
agagttctccctgtcaaactgagggaagaagtggtgcatacaaatatgccaactatgcca
agctgcactgtggaaagagagagactcctggaaaagaggcaacgtttgatggaaaaactg
ctccccagatctcctctcctggctccaagagatgttgcaccactgctggttggagaggaa
ggaaaggaggacactcgtactaaagcacaacgtccaattgataaatcaaccgtgactgaa
aacacagttagtaagccgctaaatgacactgcaaaagaaacattacaaagcacagcagag
gaagacatgatgccagcgtctgccagctcagtgctgggcgtccacgctacaggagagagg
ctgtttgtgttcagggacccgcctgaaccatgtgacatcgtaggggctcctaaaagaaaa
aagaaaaggaactttctcaatctgaagaaaggctctgtggctccgacacaactaccttga

KEGG   Notothenia coriiceps (black rockcod): 104961960
Entry
104961960         CDS       T04920                                 

Gene name
evc
Definition
(RefSeq) ellis-van Creveld syndrome protein
  KO
K19605  ellis van creveld syndrome protein 1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104961960 (evc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104961960 (evc)
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    104961960 (evc)
SSDB
Motif
Pfam: SieB
Other DBs
NCBI-GeneID: 104961960
NCBI-ProteinID: XP_010788633
UniProt: A0A6I9PN64
LinkDB
Position
Unknown
AA seq 968 aa
MTEQNVIAGCSNNGLVSFAESLHIYTGLLTVATVCGGLSGILAAALLYVFCLKPLLLTRQ
GHNARRLLEPDDGELENNQSDCISNSRKEAPSGTTKEKEKKQPPVRSDVAAFASRAKVVY
PINQKYRPLADGASNPSLHEHSKLPAMPNDDSSSSTDGDSLSQEQDNDDNSSQFISSSLV
PKSLQNQSFFRVSHYPQTLTQPGFEGRISLYCLALQDIQQQCSQLQEEKCLMFLQMLKVM
FSSRFPKDKNDAEFSKNILQMQEKELNELKKQLPKGHNDSEKDTDAPCTLEEIERAQKDL
LERGLQVSRGFSRQVEDLGQHLLKKTSIFSPDEAQEVFLSLIKTLLLVENHLVNTQEADL
NRIQQKLMWWEELAGLIQSQPALLKREVSLRQGLIATTLEQLTSDDMLSFSHMEKILSEV
QDTLTEGLQQCTEECARKTKELVNEKCSRMESKRKKLLRSQIKEKSRALELDQPHGDIQQ
LTKVYLELLMKHRQQVSDLEQQQENRVAESLCDYWKKLRTSWSKKIGELVKDIFLTTVAT
QSNVSAERCQRLWLDLEQELAEQLQQAETTTKLQLEDMRAQLERDGQVWSEEMALVQACL
KHLSEQQMTILRAMVARQSYTLNSYVGRLIEKKHEHLLVAVQRYFVVRHFCLHMLKEMRL
SKLKALSQTDFRAVLMEDPSKSQSCVNSDLKNSSASLAERHLGPESQLVGHSFQQEFLSE
LETGTELLQSHAQLVLGNALSHAIQQMMENSPSETQASPKQDDGLKRHLTETASESVYVT
KDSLTALVQSYYSHLQDIINKLQQDQTNINPEVKEQQESSSQLSRSLLRELVNWGKKPTS
AEFQQRVELHKRKVLEQCDLDQEMIYEELRRKKVAQDQNMEKIKMQIMDAEESFISELAA
LARVSLRSPDPEPSGEEDNTGYQGAAILDLLALNPALDPALNPSLTPTVVAPVKKKPKKK
RERESHLS
NT seq 2907 nt   +upstreamnt  +downstreamnt
atgacagagcagaacgtgatagcgggatgcagcaataatgggttggtcagtttcgcagag
tcgctgcacatctacactggactgttaactgtggcgacagtgtgtggagggctttcggga
atattagctgcagctctgttatatgtcttctgcctgaagcccttgctgttgacgagacaa
ggtcacaatgcaaggcggctgcttgaacctgatgatggagaattagaaaacaaccaaagt
gactgtatcagcaacagcaggaaggaggctccaagtggcaccacaaaggaaaaagaaaag
aaacagccacccgtgaggagcgatgtggctgcatttgcatcaagagcaaaggtggtttat
cccatcaatcaaaaatacagacctttagcagatggagcgtctaatccatcattgcatgag
cactccaagttgccagcaatgcctaacgacgactcatcctcctccactgacggagactct
ctgagccaagagcaggacaacgacgacaacagcagtcagtttatctcctcctcgctcgtc
cccaagagtctgcaaaaccagagcttcttcagggtctctcactaccctcagacactgaca
caaccaggttttgaaggcaggatcagcctttactgtttggccctgcaggatatacaacaa
cagtgctcccagcttcaggaagaaaaatgtcttatgtttcttcaaatgctgaaagtaatg
ttcagcagtcgctttccaaaagacaaaaatgatgctgaattctccaagaatattcttcaa
atgcaagaaaaggaactgaatgagctaaagaaacagttgccaaaaggccacaatgacagt
gagaaagataccgatgctccctgtactttggaggaaatagagagagcccaaaaagatctt
cttgaacgtggcctgcaagtgtccagaggtttcagcagacaggtggaggacttgggccag
catctgctgaagaagaccagcattttctctccagatgaagcacaggaagtgtttctctct
ctcatcaagactcttctgttagtagagaaccacctggtgaacacacaagaagcggatctc
aataggatccagcagaagttgatgtggtgggaggagctggcggggcttattcaatcccaa
cctgccttgctgaagagggaagtgtctctgaggcagggcttgatagcaacaacactggag
cagctgacgagcgatgacatgttgagctttagccacatggaaaagatcctttcagaggtt
caggacactctgaccgaaggccttcaacagtgcactgaggagtgcgcgaggaagacaaag
gagctggtgaatgagaagtgcagcagaatggagtcaaagaggaagaagcttttgaggagc
cagatcaaggagaagagccgcgccctggaactggatcagcctcacggagacatccagcag
ctcaccaaggtgtacctggagctgctgatgaaacacaggcagcaggtttctgacttggag
cagcagcaggaaaacagggtggctgaatcgctctgtgactattggaagaaactccgtacc
tcctggtcaaaaaagatcggagagctagtcaaagatatttttctcaccaccgttgctacc
cagtcaaacgtgtcagctgagcgctgccagaggctgtggttggacctggagcaggagctg
gctgagcagctgcagcaggccgagaccactaccaagctgcagctggaggacatgagggct
cagctggagagagatggacaggtgtggagtgaggagatggctttggtgcaggcctgcctc
aaacatctgagtgagcaacagatgaccatcctcagagccatggtggccagacagagctac
acactcaacagctacgtggggaggttgatagagaagaaacatgagcacctgttggttgcg
gtgcagaggtactttgtagtcaggcacttctgtctgcacatgctgaaggagatgaggctg
tccaagctgaaggcactgtctcagactgatttcagagctgtgctgatggaagatcccagt
aaaagccagtcctgtgtcaattcagacctcaagaatagcagtgccagcctagcagagagg
catctgggtccagagagtcagctggtgggccacagcttccagcaggagttcctgtctgaa
ctggaaacagggacagagcttctacagagccatgcacagctggtgctaggcaacgccctc
agccacgccatccaacagatgatggagaactcgccctctgagacgcaggcctctccgaag
caggacgatggcttgaagcgccacctgacagagactgcctcggagagcgtgtatgtgacc
aaagactctctcactgcactggtccagagctactattcccacctacaagacatcataaac
aaattacagcaggatcagacaaacatcaacccagaggtgaaagagcaacaagagagcagc
agtcagctcagcagatccttgctgagagagctggtgaactggggcaagaaacccacctct
gctgagtttcaacagagggttgaactccacaaaaggaaggtgctggaacagtgtgatctg
gaccaggaaatgatatatgaggaactgaggcggaagaaagtagcccaggaccagaacatg
gaaaaaatcaaaatgcagatcatggatgcagaagagagctttataagtgagctagcagcc
ttggctcgagtctctctccgcagccccgacccagaacccagcggggaagaggacaacact
ggttaccagggtgctgctatattggacctgctggccctgaacccagccttagatccagcc
ttgaatccttctctgaccccaacagttgtagctcctgtgaaaaaaaaaccaaagaagaaa
agagaacgagaatctcatctcagctga

DBGET integrated database retrieval system