KEGG   Notothenia coriiceps (black rockcod): 104962139
Entry
104962139         CDS       T04920                                 

Gene name
efcab7
Definition
(RefSeq) EF-hand calcium-binding domain-containing protein 7
  KO
K23852  EF-hand calcium-binding domain-containing protein 7
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104962139 (efcab7)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF_assoc_2
Other DBs
NCBI-GeneID: 104962139
NCBI-ProteinID: XP_010788840
UniProt: A0A6I9PMG7
LinkDB
Position
Unknown
AA seq 702 aa
MSFQETPVPSDEEEAFYVHCRAAYLAVFRSSLTSISSKQQLCRALQQAGRNPTHATLNKY
WTPRTSKLNFDEFFEILKSEKKTEETELMRAFKKMDVNSDGYISHSELEKALTTRGEKMT
TEEVNAIFSMADINKDGKLDYAEFCRLLVSTVEQCQTAALERLEANAKLKRQNFGSQSYS
PPKSSVSSAAATLPQPPETPRAESDTTLKKDSRSSSRPSSARSRRSSLSNSITMTSSTNK
ASKIPEPSGLQDWHHSYMKGCFFLEDDGSISSLQYQLHLPQTTTVYLITQPLSLSHGLEL
VQIPGVDSTALCSELAQIPGVDPTALCSELAQIPGVDSTALCSELAQILGVDSTALNHQK
LIITHLLPPPLRSSPPSHIPPCTVNLDNLLPLQPRLARQTPSRKDTIQNEGCRHMNSPKT
EKYVWKGELDAGTYYLLPFTSGCRLKKRSKKSLSIKPIELVYRTDTGELDLTRELREVLS
DIFEVIDLDGNGLLSLEEYNFFELRTSGEKCDKDSWAVCKENFDMRKNQLTRQGFMELNL
MEATEKDGDPADLWVTLEAMGYNRMLELVEACPFQLDVHCEGTQPAIQPLSLDSGPRLLI
QALQKSITAKTGAKALRGQDNVFIYTYRGEHRISSLIANKANQKVTVHVNNEQSRNCCSS
RGMSVFAVEVPARTKLVCQHILPINERQEWTYNCVESMLPGT
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgtctttccaggagacgcctgttccttctgatgaagaggaggctttctacgtgcattgc
agagccgcatatctagctgtatttagatcaagtttgacaagtatctcttcaaaacagcag
ttatgtcgtgctcttcagcaggctggtagaaacccaacacacgcaactctcaataaatac
tggaccccgagaacctccaaactgaactttgatgaattctttgagattcttaaaagtgag
aagaaaactgaagaaactgagctaatgagagcctttaaaaagatggatgttaacagtgat
ggctacatctcacacagtgaactggagaaagcccttaccacgagaggtgagaaaatgacc
actgaagaggtgaatgctattttctcaatggctgacataaacaaagacggcaaactggac
tatgcagaattctgcagattgcttgtgtctactgtagagcagtgtcagacggctgctttg
gagaggctcgaggctaatgccaagctgaagagacaaaactttggcagtcagtcatacagc
cctccaaagagctcagtgtcatcagcagcagcaactctccctcagcctccagaaacaccc
cgggcagaatcagacaccacacttaagaaagacagccgatcatcctcacgtccttcttcc
gctcgcagcagacggtcgtccttgtcaaactccatcactatgacatccagcaccaataag
gccagcaaaataccagagccttcaggcttgcaggactggcatcacagttacatgaagggc
tgtttcttccttgaggatgatgggagtatcagctctctgcagtaccagctccaccttccc
cagacaaccaccgtctacctaatcacccaaccactcagcctcagccatggactcgagctg
gtccaaattcctggagtggattccaccgccctctgctcagagctagcccaaattcctgga
gtggatcccactgccctctgctcagagttggcccaaatacctggagtggattccactgcc
ctctgctcagagctggcccaaatacttggagtggattccaccgccctcaaccaccaaaaa
ctgataataacacacctccttccacctcctctccgctcctcccccccatctcacattcct
ccctgcactgtcaacctggacaacctcttacctcttcagcctcggttggctcggcaaacc
ccctccagaaaagacacaattcaaaatgagggatgtcgccacatgaactccccaaaaact
gagaagtatgtttggaaaggagaattggatgctgggacatactacctgcttcccttcact
agtggctgcagactaaagaaaagaagtaagaaaagcctttctattaaacctatagagctc
gtctacaggactgacactggagaactagacctcaccagggagctcagggaggtgctgtcg
gacatctttgaggtgatagacctggatggaaatggtttgcttagtttggaggagtacaat
ttctttgagttgaggaccagtggagagaaatgtgacaaggattcctgggctgtctgtaaa
gagaactttgatatgaggaagaaccagctgacgcggcagggttttatggagctgaacctg
atggaggccacagagaaagatggagaccccgcagacctgtgggtcaccctggaggccatg
ggctacaaccgaatgctggagctagtagaggcatgcccattccagttggatgttcactgt
gaaggcactcagccggcgatccagcccctcagtttggactcagggcccaggcttctaatc
caggccctccagaagtccatcacagcaaagacaggggccaaagcactgaggggacaagac
aatgtcttcatctacacttacagaggagaacacaggatctcctcccttatagccaacaag
gccaaccaaaaagtgactgtccatgtaaacaatgagcagagcaggaactgctgcagcagc
cgaggcatgagtgtgtttgctgtcgaggtgccagccaggactaagctggtgtgccaacat
atcctgcccattaatgagagacaggaatggacctacaactgtgtagagagcatgctcccc
ggcacgtaa

DBGET integrated database retrieval system