KEGG   Notothenia coriiceps (black rockcod): 104962960
Entry
104962960         CDS       T04920                                 

Gene name
scube2
Definition
(RefSeq) signal peptide, CUB and EGF-like domain-containing protein 2 isoform X1
  KO
K24706  signal peptide, CUB and EGF-like domain-containing protein 2
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104962960 (scube2)
SSDB
Motif
Pfam: FXa_inhibition cEGF Ephrin_rec_like EGF_3 EGF_CA CUB EGF
Other DBs
NCBI-GeneID: 104962960
NCBI-ProteinID: XP_010789786
UniProt: A0A6I9PX58
LinkDB
Position
Unknown
AA seq 1021 aa
MGAIWAARDFCLFLLLLNSRQSAALPEIRADPCAEGSDGCHIDAICQTTLGSYKCTCRAG
FKGDGTHCEDVDECDFDYNGGCVHECNNIPGNYRCTCYDGFNLAHDGHNCLDVDECKFNN
GGCQHTCVNTMGSYECRCKEGFFLSDNQHTCIHRSVEGLNCMNKEHGCAHICKETPKGGV
ACECRPGFELARNQRGCILTCNHGNGGCQHTCEDTENGPICRCHVRYTLQPDKRSCVERD
EATTESADHNATSFTEVDKRVKRRLLMETCAVNNGGCDCTCKDTSTGVRCSCPVGFTLQP
DAKTCKDIDECEPHNGGCEHFCRNTIGSFECNCRKGFKLLTDERSCQDIDECYFERTCDH
TCVNSPGGFQCLCNKGYTMYGLAHCGDINECSVNNGGCEQGCENTMGGFECFCRHGYKLH
WNKKDCIEAEGHPPAKPPSKPTLNCSKQEGGDRCFLTCQSQVHISSGTEDSYTVTCGMPL
PCLADTQKNNSGLHCLGPETVSVPRIKTTATFRSGSAKCNLKRSQEKLKESLNSAHSDSR
FLFTENVQFSYVSLSCTSSGQRMRSRHGRKAGEEDGSSITAEFELDVNLEEVTADSCDLN
CVRRRSEKRLRKTIRTLRKSINREQFHLHFAGSDYELAKTLGKPAEVPGHCGVGQVLMGR
KCVSCSVGTHYDGDQGRCVLCPAGTYQDEEAQTSCEVCPRPEGRELSKVVGAGNLSECGG
QCSPGQYSHDGFTPCLPCSLGTYQPEVGRTTCFSCGGNLITKRIGAVTFRDCETKVQCSP
GHYYNSSTHRCIRCPMGAYQGEFGQNYCVSCPGNTTTDFDGSTNIMQCKNRHCGGELGDL
TGFIESPNYPGNYPANVECTWTINPPPKRRILIVVPEIFLPIEDECGDYLVMRKSSLSNS
VTTYETCQTYERPIAFTSRSKRLWVQFRSNEGNSGKGFQVPYVTYDEDYQELIEDIVRDG
RLYASENHQDILKDKKLMMALFDVLAHPQNFFNYTAQESREMFPKSFIRFLRSKVLRFLR
P
NT seq 3066 nt   +upstreamnt  +downstreamnt
atgggagctatttgggctgcaagggacttttgtttgtttttgctcttgttaaatagtcgc
caaagcgcagcgcttccagagattcgagcagatccatgtgccgagggaagtgatggctgt
cacattgatgccatttgtcagactaccctaggctcatacaagtgcacgtgcagagcaggt
tttaaaggagatggaacacactgcgaagatgtagatgaatgcgactttgactacaatggt
ggctgtgtacacgagtgcaacaatataccaggaaattatcgctgtacttgttatgatgga
ttcaatttggcacatgacggacataactgtctagatgtggatgaatgcaagttcaacaat
ggagggtgccaacacacttgtgttaacaccatgggcagctatgagtgccgctgcaaagaa
ggcttcttcctcagcgacaaccagcacacatgcatccaccgctctgtggagggtctcaac
tgtatgaataaggagcacggctgcgcccacatctgcaaagagacacccaaaggaggtgtg
gcctgcgagtgtcgtccagggttcgagctggcccggaaccagagaggctgcatcttaact
tgtaaccatggcaacggaggctgccagcacacctgcgaagacactgagaacggcccgata
tgcaggtgtcacgtcaggtacaccctgcagcccgacaagaggtcctgtgtagaacgagat
gaagccaccaccgaatctgcagaccacaacgccacatccttcacagaggtggacaaacgg
gtcaaacgaagactgttaatggaaacctgtgcggtgaacaatggcgggtgtgactgcaca
tgtaaagacacttccacaggcgtgcgctgcagctgcccggtcggctttactctgcagccg
gatgcaaaaacatgcaaagatattgacgagtgtgagcctcacaacggcggctgtgaacat
ttctgcaggaacaccatcggcagcttcgagtgtaactgcaggaaaggcttcaagctgcta
acagatgaacgctcttgtcaagatatagatgaatgttatttcgagcggacatgtgaccac
acgtgtgtgaactcccccggtggttttcaatgtctgtgcaacaaaggctacaccatgtac
gggctggcccactgcggagatataaatgaatgcagtgtgaacaatggcggttgtgagcag
ggttgtgagaacaccatgggtggatttgaatgcttttgccgtcatggctataagctacac
tggaacaaaaaggactgcattgaggctgagggtcacccacctgctaaacccccctctaaa
cctaccttgaactgtagtaagcaggagggaggggaccgctgcttcctgacatgccagtcc
caagttcacatcagcagtgggacggaggattcatacacggtgacctgtggaatgcctctg
ccctgcttggctgacacacaaaagaacaacagtggattgcattgcttaggtccagaaacg
gtcagtgtcccacgcattaagactacagccacctttaggtctggctctgcaaaatgcaac
ctaaaacgaagtcaggagaaactcaaggagagcttgaactcagcacactcagatagcagg
ttcctcttcactgaaaatgtccagttcagctatgtgagcctgagctgcacctcgtccgga
cagcgaatgcgcagccgccatggcaggaaagctggggaggaggacggctcctcgataaca
gctgagtttgagctggatgtgaacctagaggaggtaacagcagacagctgtgacctgaac
tgtgtgcgccggcgctcggagaagaggctcaggaagaccatccggaccctgagaaagtcc
ataaaccgggaacagttccacctccacttcgctgggtccgactacgagctcgctaagact
cttggcaaaccagcagaagtgccagggcactgtggggtgggacaggtgctgatgggcagg
aagtgtgtgagctgcagtgttgggacacactacgacggggatcagggaaggtgtgtgctg
tgtccggctggaacctatcaggacgaggaggcacagacatcttgtgaagtctgtcccaga
cctgaaggaagagaactctccaaggtggttggcgctggaaacctgtcagagtgcggaggt
cagtgttccccgggtcagtactcccatgatggcttcaccccctgcctgccctgttccctg
ggaacgtaccagcctgaggtgggacgcaccacctgcttctcctgtggagggaatctgatc
accaagcgcatcggagctgtcacctttcgggactgcgagaccaaagtccagtgctctcct
ggacattactacaacagcagcactcaccgttgcatccgctgtcccatgggcgcgtaccaa
ggagagtttggacagaactactgtgtctcctgccctggaaacaccaccaccgacttcgat
ggctctactaacatcatgcaatgcaaaaaccgacattgtggaggagagctgggagatttg
actggcttcatcgagtcccccaactacccggggaactaccccgccaacgtggagtgcacc
tggaccataaaccccccgcccaaacgcaggatcctgattgtcgtcccagaaatcttcctg
ccaatcgaggatgagtgcggagactacttagtcatgagaaagagctctctctcaaactct
gtgacaacctacgagacttgtcagacatacgaacgtcccattgctttcacctcccgctca
aaaaggctctgggtccagttcaggtccaacgagggaaacagtggcaaaggcttccaggtc
ccgtatgtgacatatgacgaggactaccaagaattgatagaagacatagtcagagatggg
agattatacgcttcagagaatcaccaggacattcttaaggacaagaagctcatgatggcg
ttgttcgatgtactggctcaccctcaaaacttcttcaactacacagcacaagaatcaaga
gaaatgttccccaaatcattcatccgcttcctgcgctccaaagttctgagattccttcgc
ccttaa

DBGET integrated database retrieval system