KEGG   Notothenia coriiceps (black rockcod): 104963734Help
Entry
104963734         CDS       T04920                                 

Definition
(RefSeq) trypsin-2-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104963734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ncc01002]
    104963734
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ncc04147]
    104963734
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     104963734
Peptidases [BR:ncc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104963734
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104963734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 104963734
NCBI-ProteinID: XP_010790678
LinkDB All DBs
Position
Unknown
AA seq 244 aa AA seqDB search
MLLLTVLLLVATNAALGFDDKIVGGYECRDHSVPWQVSLNNGWHYCGATLINERWVLSAA
HCYKGEDIELRLGEHHIGYKDGPEQFIAAAVIIRHPDYDRYNINNDIMLIKLAQPAKINE
YVRPMALPSSCAPAGTQCLVSGWGATQSPFGCTKCLHCLDLPILSQQDCESSYPDRITSS
MFCAGFIQGGKDSCQGDSGGPLVCNGELHGVVSWGWGCAEENRPGVYAKVCQFTDWIHAT
IASH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctcactgtgctcctgttggttgctaccaatgctgccctgggctttgatgat
aagatcgtggggggctacgagtgcagggaccactctgtcccctggcaggtgtccctcaac
aacggctggcactactgcggcgcgaccctgatcaacgagcgctgggtcctcagcgctgct
cactgctataagggggaggacatcgagctgcgcctgggggagcaccacatcggctacaag
gacggccccgagcagttcatcgctgctgccgtcatcatccgccaccccgactacgaccgc
tacaacatcaacaacgacatcatgctgatcaaactagcccagccagcaaagattaatgag
tatgtccggcccatggccctgcccagcagctgtgcccctgcagggacccagtgcctggtc
tctggctggggggccacccagagccccttcggctgtacgaagtgcctgcactgcctggac
ctgcccatcctgtcgcagcaggactgtgagagctcctaccccgacaggatcacctcctcc
atgttctgtgccggcttcatccagggaggcaaggactcctgccagggagactctggtggc
cctctggtgtgtaacggggagctccacggtgtggtgtcctggggctggggctgtgctgaa
gagaatcgccccggggtttacgccaaggtctgccagttcactgactggatccacgccact
attgcctctcactga

DBGET integrated database retrieval system