KEGG   Notothenia coriiceps (black rockcod): 104964295Help
Entry
104964295         CDS       T04920                                 

Gene name
wdhd1
Definition
(RefSeq) WD repeat and HMG-box DNA-binding protein 1 isoform X1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104964295 (wdhd1)
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    104964295 (wdhd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 HMG_box eIF2A HMG_box_2 Nup160
Motif
Other DBs
NCBI-GeneID: 104964295
NCBI-ProteinID: XP_010791340
LinkDB All DBs
Position
Unknown
AA seq 1158 aa AA seqDB search
MFLTQRGRFRSRGTESTGEIRGSFVKMPCERKPMRYGHSEGHTEVCFDDSGKFIVTCGND
GDVRIWEGLDDDDPKFITVGEKAYSLALKNNKLVTASSNNTVQIHTFPDGDPDGILTRFT
TNATHVTFNSSGSRVAAGSSDFMVKVVEVSDSSQQKTLRGHEAPVLSVTFDPKDDFLASA
SCDGNVVVWNIKEQSQLISWPLLQKTNDVSNAKSLCRLAWQPGTAKFLAVPVESKVQLYE
RGSWDHVSTLSDDLLTQLVNVVAWSPCGQFLAAGSVGGSLNVWDVSSKLCVERQKHEKGF
TVCGLAWHPSGSQIAYTDTEGCLGLLDGLRTSTSNSTNTASKQAAVTKPAKDYDALFDDD
DDDRVMDEGQSDTNSPVKKPIAGGDDDDDDDDFLMPATGRVRSRAILDDENSLDTGSLKL
GQEKFGDDDNTGSGVVPAAPLVPLRPAYEGPMPTPPQKAFQPGSTPAHLTHRFMMWNSVG
IVRDYNDEQDNAIDVEFHDTAVHHAMHLTNTLGHTMADLSQEAVLLACPGTDELASKLQC
LHFSSWDTNKEWMVDLPQGEDVRALCLGQGWAAVATSALMIRVFSIGGVQREIFSLPGNV
VCMVAHGEQLLIVYHRAPGFDGEQALGVQLLQFGRRKRQLIHGEPLPLSHRSYLSWLGFT
AEGTPCYVDSEGAVRMLNRSVGNTWTPVCSTRETCKSKSDSYWVVGIHENPQQLRCIPCK
GSRYPPTLPRPAVAILPFKLPLCQTSTEKGQMEEQYCRSLLFSNHFSFLSSSGYEIDEEA
QSQSQKDQQELLMKMFALSCKLEREFRCVELAELMTQKVVTLAIRYASRSRRMALAQRLS
EIALEKSNQIQEVEPEEEEEEEEDYSSVRRPSGSGQSEAAQGRHSSRRYQEEEEEQEEEQ
REEEEGREMETDEASETKKRVNLFAKEAVSPVKTNLTPITKGGRANPFKVLGSGKPSSAS
GQPRVTNILDNMTTSRKSFPLSGPAGKQNKNTVLKPLAPRPKTKTQSTLLQMSGTKASNK
KTQQNTQPAADTQKQPEAPPPASPADNTENKRPKTGFQFWLEENRKSITADNPDLEETDV
IKEAMGRFRTLSAEDRLSWTERAKTGDAADLKKRKRAEGGAEGAEIEKGQAEADENSAKK
KKSLDPSSKLSAFAFNKN
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgtttttaacgcagcgcgggagatttaggagcagaggaacagagtcaaccggggaaatt
cgtggtagctttgtgaaaatgccttgtgagaggaagccaatgcgctacggccactcggag
ggacacaccgaggtctgcttcgacgactctgggaagttcattgtaacctgcgggaatgat
ggagatgttcggatatgggagggtctggatgatgatgatccaaagttcattacggtcggg
gaaaaggcttactctctcgcactcaagaacaacaagctggtgacagcgagctccaacaac
acggtgcagatccacacttttcctgatggagatccagatggcatcctgacccggttcacc
accaacgccacacatgtcaccttcaacagcagcggctccagggtcgctgcaggatccagt
gacttcatggttaaagtggtggaggtgtcggacagcagccagcagaaaaccctccggggc
cacgaagcgcccgtcctcagtgtcacctttgaccccaaagacgacttcctggcgtccgcc
agctgtgacggcaacgtggtggtgtggaacatcaaggagcagtctcagctgatcagctgg
cctctgctgcagaagaccaacgacgtcagcaacgcaaagtctctgtgtcggctggcctgg
cagcccggcacggccaagtttttggcggttcctgtggagtcgaaggtgcagctgtacgag
cgagggtcctgggatcatgtgagcactctgtctgatgatctgctgactcagctcgtcaac
gtggtggcctggtctccatgtgggcagttcctggcagctggcagcgtggggggttcacta
aatgtgtgggacgtgagcagcaagctgtgtgtggaaaggcagaagcacgagaaaggcttc
acagtgtgcgggttggcctggcacccgtcaggcagccagatcgcctacaccgacaccgag
ggctgcctgggtctgctggacggactccgcacctccacttcaaactccaccaacactgcc
tcaaagcaggcagcggtaacaaaaccagcgaaagactacgatgcactgtttgacgatgat
gatgacgacagagtcatggatgaagggcagagtgacaccaactccccggttaagaaaccc
atcgccgggggcgatgacgacgatgatgatgatgatttcctcatgcctgcgaccggcagg
gtgaggagcagagccatcctggatgatgagaattccctggacaccggatctctaaagctc
ggtcaggaaaaatttggggacgatgacaacacgggcagtggcgtcgtgcccgctgccccg
ctggtgcccctgcgtcccgcctatgaggggcccatgccgacgcccccccagaaggccttt
cagccgggctccacccctgcacacctcacacaccgcttcatgatgtggaactcggtggga
atagttcgagactacaacgacgagcaggacaacgccatcgacgtggagtttcacgacacg
gccgtgcaccacgccatgcacctcacaaacacgctgggccacaccatggctgatctttcc
caggaggccgtgctgctggcttgccccggcacagacgagctggccagtaagctccagtgc
ctccacttctcgtcctgggacaccaacaaggagtggatggtggacctgccgcagggcgag
gacgtgcgggcgctgtgtctggggcagggctgggcggccgtggccaccagcgcgctgatg
atcagagtcttctccatcgggggggtgcagagggagatcttcagcctgccggggaacgtg
gtctgcatggtggcccacggagagcagctgctcatagtctaccatcgggctccagggttt
gatggggaacaagctctgggtgtccagctgctgcagtttggtcgaaggaagaggcagctc
atccatggggagcccctccccctgtcccacagatcctacctgtcctggctcggattcact
gctgaaggcacaccatgctacgtggattcagagggggcggtccggatgctgaaccgctcc
gtgggcaacacatggaccccggtgtgcagcaccagagaaacctgcaaaagcaaatcagac
agctactgggtggtgggaatacacgagaaccctcagcaactcaggtgtattccctgtaaa
ggctcccggtaccctcccactcttccccgacctgctgtggccatcctgcccttcaagctg
cctctgtgtcagacctccacagagaaaggacagatggaggagcagtactgtcgctcgctc
ctcttcagcaaccacttcagcttcctgtcgtcaagcggctacgagatcgacgaggaggct
cagagtcagtcccagaaggaccagcaggagctgctcatgaagatgttcgcactgtcctgt
aagctggagcgggagttccgctgcgtggagctggcggagctcatgactcagaaagtggtg
actctggccattcgatacgcgtcccggtccagacgcatggccctcgcccagcggctcagt
gagatcgcactggagaaatccaaccagatccaagaagtagagccagaagaagaagaagaa
gaagaggaagactactcgagcgtcagacggccctctgggtctggccagagtgaggctgca
caaggacggcacagcagccgacgttatcaggaagaggaagaggagcaagaagaagagcag
agggaggaagaggaaggacgggagatggagacggacgaggcatcggagacaaaaaaacgt
gtcaatctgtttgctaaagaagcagtttcacctgtgaagaccaatctgacgccaattact
aaaggaggacgtgcaaatccctttaaggtcctgggctcagggaaaccctcgtctgcgtcc
ggccagcctcgagtgaccaacatcctggacaacatgacgaccagcaggaagtccttccca
ctcagcggacctgcggggaaacaaaacaaaaacactgtcctcaaaccgctggcccccagg
cccaaaacaaagacccaatccactctgcttcagatgagcggcaccaaggcgtccaataag
aaaactcagcagaacacacagccggctgctgatacgcagaaacaaccagaagcccctcct
ccagcctctcctgccgataacacagagaacaagaggccaaagacgggcttccagttctgg
ctggaggagaacaggaagagcatcacggctgataaccccgacctggaggagacggacgtc
atcaaagaggccatgggacgcttcaggacgctgtcagccgaggacagactgtcctggacg
gaaagagcaaaaactggagacgcagcagatctgaagaagcggaagagggccgaaggagga
gcagagggtgcagagattgagaaaggacaggcagaagcagatgaaaatagtgccaagaag
aaaaaatctctagatccatcctccaagctttcagcatttgcttttaacaaaaactaa

DBGET integrated database retrieval system