KEGG   Notothenia coriiceps (black rockcod): 104964515Help
Entry
104964515         CDS       T04920                                 

Definition
(RefSeq) transcription factor PU.1-like
  KO
K09438  transcription factor PU.1
Organism
ncc  Notothenia coriiceps (black rockcod)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ncc03000]
    104964515
Transcription factors [BR:ncc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    104964515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 104964515
NCBI-ProteinID: XP_010791627
LinkDB All DBs
Position
Unknown
AA seq 259 aa AA seqDB search
MMEGYVISSVSEGIIPNEPESYRPPTELYPYLTNVGEIYEDHRWTFHTERVHPTDFENSP
VNHLIELQSVSPQQLVQPYRFSSESLPLHLDPPLVPLSVSPQIPYYTPSMCYQYQASASP
GRYYSEEEQRGVSPPFEVSEGEDEREEHKHSFRRDTSNKKKIRLYQFLLDLLRKGDMSDS
IWWVDQDKGIFQFSTKHKEVLASHWGTQKGNRKKMTYQKMARALRNYGKSGEIKKVKKKL
TYQFSEDVLRNLYLRQYPH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatggagggatatgtcatatcatctgtgtcagagggaatcattccgaatgaaccagag
agttatcgcccccctacagagctgtacccctacctcactaatgtgggggagatatatgaa
gaccacagatggactttccacacggagcgtgtccacccgacagactttgagaattctccg
gtgaatcacctcatagagcttcagtccgtgtctcctcagcagctggtgcagccgtaccgc
ttcagcagcgagtcgctgccccttcacctggacccgccacttgttcctctctctgtgtca
ccacagatcccatattacaccccatccatgtgctaccagtaccaggcatctgcctctcct
ggacgttactactcagaagaggaacagagaggagtcagccctccgttcgaagtatcagaa
ggagaggatgaacgagaagaacacaaacactccttcaggagggacactagcaacaagaag
aaaatccgcttgtaccagttcctcctggacctgctaagaaaaggtgacatgagtgacagt
atctggtgggtggaccaggacaagggcatctttcagttctccacaaaacacaaagaagtc
ctggccagccactggggtactcagaaaggaaatcgcaaaaaaatgacctatcaaaaaatg
gctcgagctctgaggaactatggtaaatctggagagattaagaaagtaaagaagaagcta
acctaccagttcagtgaggatgtgttgaggaacctctatttacgtcagtatcctcactga

DBGET integrated database retrieval system