KEGG   Notothenia coriiceps (black rockcod): 104964793Help
Entry
104964793         CDS       T04920                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00052  Galactose metabolism
ncc00500  Starch and sucrose metabolism
ncc01100  Metabolic pathways
ncc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104964793 (gaa)
   00500 Starch and sucrose metabolism
    104964793 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104964793 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ncc04147]
    104964793 (gaa)
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104964793 (gaa)
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104964793 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 104964793
NCBI-ProteinID: XP_010791964
LinkDB All DBs
Position
Unknown
AA seq 927 aa AA seqDB search
MSMGLLSHFTAAVLLLLFTFLCFYTNHLSIHQNRLVRSVSAQHTEAHTILGYYYPAKPQN
KSVETRTVISRADKCTLAPESRFDCARDRLLTQRECEERGCCYAPLPHSAGPPWCFYPSL
YPGYKMGPLTPTTRGQEATLTRATPSYLPKDIATLHLEVTEEAAGCLHLTFKDPSSQRYE
VKLPAGVPQSPADTQDVLYTTEYQAEPFGFIVRRKSNGRVIMNTTVAPLLFADQYLQLST
TLASSLVSGLGEHYTPLLLDLNWTSVTLWNRDMAPHADANLYGSHPFYIVQEEDGLAHGA
FLLNSNAIEVMLQPTPALTWVAIGGVLDLYVFVGPDPQSVIRQYLQVIGYPMMPPYWSLG
FHLCRWGYTTSNTTRHVAQRMHNAKFPMDVQWNDLDYANKRRVFTFDPWRFGDLPQMVDE
FHRSGMKYILILDPGISSRSPPGTYPPFDDGLKRDVFIKNSTGQILIGKVWPGPTAFPDF
TNPETGRWWEDCIRDFHSKVPVDGLWIDMNEPSSFVQGSVEGCPDSDLENPPYTPRVVGG
KLNSGTICLSAQQKLSTHYNLHNMYGLTEASATHSALMKVRGKRPFVLSRSSFPGIGRFS
GVWTGDVRSDWEQLRYSIPAVLHFGLFGVPLVGADICGFGGNTTEELCVRWMQLGAFYPF
MRNHNDKPNAPQEPYVFGQKAQAAMRSALNLRYSLLPFLYTLFHHAHTSADTVARPLFVE
FPTDPNCQTIDRQFLWGSSLLISPVLERGAEELAAYLPPATWYSLHNGQPFYSKGQYLLL
PAPLDTINVHVREGHIIPQQEPALTTAVSRRNPFFLTVALSAGGWAWGDLFWDDGDSLDT
FETGNYCYVIFMAGQCQVVSDPLRLNGALDGLVLGGLQVFGVPSPPLYVLANGEQVRDFM
YRSDTKVLTVTNLALPMSTVFRVQWAL
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgggtctgctttctcactttactgcagctgtgctcctgctgctctttaccttt
ttatgtttttacaccaaccacttgtctattcatcagaacagactggttagatcagtttct
gctcagcacactgaagcacatacaatacttggttattattatccagcaaaaccacagaac
aagtcagtagaaacaaggactgttatatccagagctgataaatgcaccctggccccagag
agtcggtttgactgtgccagggacaggctgctcacccagagagagtgtgaagagaggggc
tgctgctatgcccccctgcctcactctgcaggaccaccttggtgcttctaccccagtttg
taccctggctacaaaatgggtcctctcacccccaccacacgaggacaggaggccaccctg
actcgtgccaccccttcatatctccccaaagacattgccactctacacctagaagtgaca
gaggaggctgcaggctgcttacacctcacttttaaggacccatcatctcagcgatatgag
gttaagctcccagctggtgttcctcagagcccagctgatacccaggatgttctctatacc
actgaataccaggcggagccatttggcttcatagtgcgccggaaatctaatggaagggtt
atcatgaataccacggttgctcctctgctgtttgctgaccagtacctgcagctgtccacc
acgctggcctcttcccttgtgtccggcctcggggagcattacacccccctcctcctggac
ctgaactggacctctgtcactctctggaacagagacatggcgccccacgctgatgctaac
ctctatggctcccacccattctacatagtccaggaagaggacggcttggcacatggagct
ttccttctcaacagcaatgcaatcgaggtgatgttgcagccgacccctgctctcacatgg
gtggctatcggtggagtcctggacctgtacgtttttgtgggtcctgatcctcaaagtgtt
atacgacagtaccttcaggtcattggctatcctatgatgcctccttattggtcgttgggc
tttcatctgtgtcgctggggttacacgacatctaatacaacccggcatgttgcacagcgc
atgcacaatgctaagtttcccatggatgtgcagtggaatgatctggactatgcaaataaa
cgcagggtgttcacatttgacccgtggcgatttggagacctcccacagatggttgacgag
ttccataggagtggcatgaaatacatccttatcctggaccctgggatcagcagcagaagc
ccccctggcacttacccaccgtttgatgatgggctgaaacgagacgtcttcataaaaaat
tctacaggacaaatcctgatagggaaggtttggccaggccccacagccttccccgacttc
accaacccagagaccggacgctggtgggaggactgcatcagagattttcattctaaagtt
cctgtggatggtctatggattgatatgaatgaaccatccagttttgtgcagggctcagtg
gagggctgtcctgacagtgaccttgagaacccgccctacacacccagagttgttggaggc
aagttgaactcgggaactatttgtctttcggcccagcagaagctgtccactcactacaac
ctgcacaatatgtacggactgacggaggcctctgccactcacagcgctctcatgaaggta
cgaggaaagagacccttcgtcttgtctcgctcctccttccctggcatcggacgcttctct
ggagtctggacaggagacgtccggagtgactgggagcagctccgatactccatccctgct
gtgctgcacttcggcctgttcggggttcccctcgtgggggcggacatctgtggttttggc
gggaacaccactgaggaattgtgtgtacgctggatgcagctcggggccttctacccattt
atgaggaaccacaatgacaagccaaacgctcctcaggagccctatgtttttgggcagaag
gcccaggcagccatgcggagtgcattgaaccttcgttactcccttctccctttcctctac
acactcttccatcatgcgcacacctctgctgacactgtagccaggccactcttcgtggag
tttcccactgaccctaactgtcagaccatagaccgacagttcctttgggggagttccctt
ctcatcagcccagttttagagcggggggcagaagagctggctgcttacctgccccctgcc
acttggtacagtctgcacaatggtcagcctttctacagtaagggtcagtacctgctcctg
ccagcccccctggacaccatcaacgtccatgtgagggaaggacatataatcccccagcag
gagcctgctttgacaacggcagtctctcgcagaaaccctttcttcctgacggtggcgcta
tcagcaggaggttgggcatggggagacttgttctgggatgacggggacagtctcgacacc
tttgaaacgggaaattattgttacgttatcttcatggctggacagtgtcaggtggtgagt
gatcccctcaggcttaatggggctctggatggtctggttcttggagggctgcaggttttc
ggggttccctccccacccctatacgtgttagccaatggggaacaagtcagggatttcatg
taccgcagtgacaccaaggttctaacagtgaccaacctggccttgcccatgtcaacggtg
tttagagtccaatgggctctctga

DBGET integrated database retrieval system