KEGG   Notothenia coriiceps (black rockcod): 104964880
Entry
104964880         CDS       T04920                                 

Gene name
tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04060  Cytokine-cytokine receptor interaction
ncc04068  FoxO signaling pathway
ncc04144  Endocytosis
ncc04218  Cellular senescence
ncc04350  TGF-beta signaling pathway
ncc04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104964880 (tgfbr2)
   04350 TGF-beta signaling pathway
    104964880 (tgfbr2)
   04068 FoxO signaling pathway
    104964880 (tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104964880 (tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104964880 (tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    104964880 (tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104964880 (tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104964880 (tgfbr2)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     104964880 (tgfbr2)
Protein kinases [BR:ncc01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   104964880 (tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal TMEM100
Other DBs
NCBI-GeneID: 104964880
NCBI-ProteinID: XP_010792082
UniProt: A0A6I9PVC1
LinkDB
Position
Unknown
AA seq 541 aa
MELLRFSAFWCGAILFGSFQLKEAEAYTIKLSRLCKFCDVQPTACTGKGSCKVECDITAI
CPSNEDVCVSIWRRKDDNFTFDTVCHNRYQKLDGLVLEDYNNSKCEMKERKGMGSEFFIC
SCSEDECNEQIFFNSNSDSQVVAVILVSLVPLLVMAVLVITSFYCYRVYRQRQASSRRKK
GLPMDFSDGRAIMDDEGSDSSSTHANNLNHNTELLPIELDVQVGKGRFAEVYKAKLKQGS
SVSEEQGFETVAIKIFQYEEYASWKNEKDIFSDADLRHENVLHFLTAEDRKAQRQCWLIT
AYHPRGNLQEFLIHHIVSWQDLWTLGFSLAEGVAHLHSDLLPGGRYKVPIAHRDIKSSNI
LVKDDLTCCLCDFGLALRLDNALSVDELANSGQVGTARYMAPEVLESRINLENIESFKQA
DVYSMALVLWEIISRCSAIGEVKEYEPPFGNLREHPCVESMKDSVLRDRGRPEVPDSWIS
HPGIQMVCASIDECWDHDPEARLTAQCVAERFDEMEYLDKLSVRSDSEEKIPEEILMVDE
K
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggagctacttcggttttccgctttttggtgtggagcgatactcttcggtagttttcag
ctcaaggaggcggaggcttacacgataaaactatcaaggctgtgcaagttctgtgatgtc
cagcccaccgcctgcacgggtaaagggagctgcaaggtggagtgtgatatcactgccatc
tgccccagcaatgaagatgtgtgtgtcagtatctggaggaggaaagatgacaatttcacc
tttgacacagtctgtcataaccggtatcagaagctggacggcctggtcctggaggattac
aacaacagcaagtgtgagatgaaagaaagaaagggcatgggctcagagttcttcatctgc
tcctgctctgaggacgaatgcaatgagcaaatcttctttaactccaactcagattcccag
gtggtggcggtcatcctggtgagcctggtgcctctgctggtcatggctgttctcgtcatc
acgtccttttactgttaccgggtctaccgccagcggcaagccagctccagacgcaagaag
ggtcttccgatggatttcagtgacggtcgggccatcatggatgatgaaggttcagacagt
agctccacgcacgccaacaacctcaaccacaacacagagctgctgcccattgaactggac
gtccaggtcgggaagggacgctttgcagaggtttacaaagccaagctcaagcagggctcc
tcagtcagcgaggagcaaggctttgagactgtggccattaaaattttccaatacgaggag
tacgcctcttggaagaacgagaaggacattttctcagatgcagacttgagacatgagaac
gtgcttcacttcctgacagcagaggataggaaggcgcagagacagtgctggctgatcaca
gcctaccatccaagagggaacctccaggagttcttgatccaccacatcgtcagctggcag
gacctgtggacgctgggtttttcactagctgagggagtggctcatcttcacagcgacctc
ttgcccggtggtcgctacaaggtgccgatcgcacacagggacattaagagctccaacata
ctcgtgaaagacgacctgacctgctgcctgtgtgactttggactggccctccgcctggac
aatgctctgtctgtggatgagctggccaacagtgggcaggtgggtacagccaggtacatg
gccccagaggtcctggagtccagaatcaacttagaaaacattgagtccttcaaacaggcc
gatgtttactccatggctcttgtgctgtgggagataatctccagatgtagcgcaattgga
gaggtgaaagagtacgaaccgccctttgggaacttgagggaacacccatgtgtggagagc
atgaaggacagcgttctgcgggacagaggaagacctgaggtccccgacagctggatcagc
catccaggcatccagatggtgtgtgcctccatagacgagtgctgggaccacgacccggaa
gcccgtctgacagcccagtgtgtggctgagcgcttcgacgaaatggagtacctggacaag
ctgtcggtgcgctctgactcagaggagaagatccctgaggaaatcctaatggtggatgag
aagtag

DBGET integrated database retrieval system