KEGG   Notothenia coriiceps (black rockcod): 104964887
Entry
104964887         CDS       T04920                                 

Gene name
kif7
Definition
(RefSeq) kinesin-like protein KIF7
  KO
K18806  kinesin family member 7
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104964887 (kif7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ncc04812]
    104964887 (kif7)
Cytoskeleton proteins [BR:ncc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     104964887 (kif7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 104964887
NCBI-ProteinID: XP_010792085
UniProt: A0A6I9PWF8
LinkDB
Position
Unknown
AA seq 1358 aa
MSPKVPSGQGRGDYSAVQVAVRVRPLLPKELLHCHESCITVDSELCRVTLGHDRHFLCDY
LFEETCCQDDVYSLSVQPLIDAFFQGFNATVFAYGQTGSGKTYTIGEANICSFRDEEQGI
IPRAVADVFKLLDENDLNDFSVRVSYLEVYKEEFNDLLEVETASKDILIREDKGNIVLYG
VKECEVEGLDEVLSLLESGNTARHTGATQMNQNSSRSHTIFTVYMDQRRGASRLYGSAAN
SGPQMLSSKFHFVDLAGSERILKTGNTGERLKESIQINSGLLALGNVIGALGDPKRKGSH
IPYRDSKITRILKDSLGGNSKTLMIACISPSSSDFDESLNTLNYATRARNIQNRATVNCK
REPDRVEGLEQQIKALRRALENRQRSETRIISHADPSRRPRLGEGEISRLQAQSAHYRTC
TDTAYRLLRELQSEGALSAEQSLRVKEWLCSVEEERSGLTTGSGPDSGIENSSNEDTVGL
RRGWPSVRNQDPEAAEERWSLEHGEKEESMDMLQAQIQRLEGENTDFLAALEDAMEQYKQ
QSDKLQEQQDLIAELQCLLSTPGLTGLGHNLRPRPHTAPIGSLVHSQNGGKHRQISPVGC
LGDGMFGDQDGSLYEEQENLRGAELEDTEEEEARLYDLSLERRQQVNMTWTRRNALSGAP
AVGVRGLISLPYPDQHRCLARKASNSSAGETSVRESLKSFEGVSDRGLLQAQQKIRELSV
TIRMKEELIKELVKTGKDAQALNKQYSHKITALEREAVQARQELQEAQRQLQDLERQERD
VSASDKTRAQECRRKIAAAQSKVQVLSQRQRDTARLANLPAQSERRVLELERSVQSMRTQ
QEQLQKRLRQESQQKRRLETEMQRRTHRVKELEIKNEQQQKILRIKTEEVAAFQRQRRSG
SNGSVISLEEQQKIEEQKRWLDEEMERVLGQRKELEDLEGELTKRETILAKKEALLQERS
GLETKRLRSSQALSQNLVTLTGRIESLEQELSDRNGQLRSSSAQDSQQIRQEISNLRQEK
DSLLKQRVELDDKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITQRQRQLRASA
SMLSQWEVNLMAKLSYLSASETRALLCKYFDKVVTLREEERKLQLALAELEMQLDEQQKL
VQWLDNALDRTQLDTDRRLTQQQKEHERSVQLLLQQCRDQIDEGLAGRQRQYEGWIHNLS
MELNHYKAANLELSNKLRELCGPGSHPKEHIKAYDGRAAGIDSMEKLTRFPEDSSGGRSP
DQACRSREEMRELVNTPLPSTWRRSSLPTEEPAVMEELWLQAAGDVPVNRVVQTGAGSWG
GPVPMPVVKSRRESRRSSLNIGPLTSNNSLIDVRKNPV
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgtctcccaaggttcccagtggccaaggcagaggggattattctgcagttcaagtagct
gtccgagtgcgtcccctgctgcccaaagagcttcttcactgccacgagagctgcatcacc
gtggactcagagctgtgtcgtgttactctgggtcacgacagacactttctttgcgactac
ctttttgaagaaacttgctgccaagacgatgtttactctttgtctgttcagccgctcata
gatgccttctttcaaggtttcaatgccacagtgtttgcctatgggcagacaggctcaggc
aagacttacaccatcggggaagctaatatctgttcctttagagatgaggagcagggtatc
atccccagggctgttgcagatgtcttcaagctgctggatgaaaatgacctcaatgacttc
tctgtccgcgtctcctatctggaggtctacaaagaggagttcaacgacctgctggaagtg
gagactgccagcaaggacatcctcatccgggaggataaaggcaacattgttctgtatggc
gtgaaggagtgcgaggtggagggtcttgatgaggtgttgagtttactagagtcaggaaac
acagccaggcacactggtgcaacccagatgaatcagaactccagccggtcacacaccatt
tttaccgtgtatatggaccagcgccggggagcctctcgcctttatgggtctgctgcaaat
tctggaccgcaaatgttgtcttccaagttccactttgttgacctcgcggggtcagagcgc
atcttaaagacgggaaacaccggcgagagactgaaagagagtatccagattaacagcgga
cttctggctctgggaaatgttatcggagcactcggagatcccaagaggaaaggctcacac
ataccatacagggattctaaaatcacaaggatcctaaaagactctttgggaggaaattca
aaaaccctgatgattgcctgcatcagcccctcttcgtcagactttgatgagagcctgaat
acactaaactacgccacaagggccagaaacattcagaaccgggcgacggtcaactgcaag
cgtgagcctgatagggtagaagggctggagcaacaaataaaagcccttcgcagagccctc
gaaaaccgccagcgctcagagacccgcatcatttctcacgcggatccaagcaggagacct
cgacttggagagggagagatcagcagactgcaggctcagagcgcccactacaggacgtgc
acagacactgcctacaggttgctgcgggagctgcagagtgaaggggctctgagtgcagag
cagagtctgagagtgaaggagtggctgtgctcagtggaggaggagcgcagcggactgacc
acgggctccggacctgacagcggcatcgagaacagctccaatgaagacactgttgggttg
aggagaggctggccctctgtgaggaaccaggatccagaggctgcggaggagaggtggagc
cttgagcatggagagaaagaggaaagtatggacatgcttcaagcacagatccagcggctg
gagggagagaacacagactttttagctgctctggaggacgctatggagcaatacaagcag
cagagtgataagctgcaggagcaacaggacttgatagcagagctgcagtgtctgctgtcc
actccagggctgacgggcctgggccataacctgagaccccggcctcacacagcccctatc
ggctccctggtacacagtcagaatggaggcaagcacagacagatcagtccagtggggtgt
cttggtgatgggatgtttggtgatcaggatggtagcctgtatgaggagcaggagaaccta
agaggagcagagcttgaggacacagaagaagaagaggccagactttacgacctcagcctg
gagagacgccaacaggtgaacatgacctggaccaggaggaacgcgctgtcaggagcacca
gcagtgggtgttagaggtcttatctctctgccttatccggaccagcaccgctgtttagcc
agaaaagcatccaactccagtgctggggagacatctgtgcgtgaaagtctgaaaagcttt
gaaggtgtttcagacaggggtcttcttcaggcacagcagaagatcagggagctctctgtc
accatccgtatgaaggaggagctcatcaaggagctggtcaaaacgggtaaggatgctcag
gccctgaacaagcagtacagccataagatcacggctctggagcgtgaagctgttcaggct
cgacaggagctgcaggaggcccaacggcagctgcaggatctggagaggcaagagagggac
gtcagcgcatcggacaagaccagagctcaggaatgtcgcaggaagatagctgctgctcag
agcaaagtccaggttctcagtcagcgtcagagggacaccgctcgcctcgctaaccttcct
gcccagagcgagcggcgagtgttggagctggagcgaagcgttcagagcatgaggacgcag
caggagcagctgcagaagaggctgcgccaggagagtcagcagaaacgacgtctggagacc
gagatgcaaagaagaacccacagagtcaaggaacttgagataaaaaatgagcagcagcag
aagatcctcaggataaagacagaggaggtcgctgccttccagaggcagagacgcagcggc
agtaacggctctgtcatctcattggaagaacaacagaagattgaggaacaaaaacgctgg
ctggatgaggaaatggagcgggtactgggccagcggaaggaactggaagatctggaagga
gagctcactaaacgagaaacaatcctggccaagaaggaagccctgctgcaggaacgcagc
ggactggagacaaagaggcttcgctccagtcaggcactgagtcaaaacctggtgactctg
acggggcgcattgagtcacttgagcaagagttgagtgataggaatggacaacttcgcagc
agcagtgctcaagactcacaacagattcgtcaggagatctccaacctgcggcaagagaaa
gattccctgctcaaacagagagtggagctggacgataagctgcggcagggcagcctgctc
tcacctgaggaggagcgaacacttttccagttggacgaggcgatcgaggctctggatgct
gccatcgagtacaaaaatgaggccatcactcagagacagagacagctgagggcttctgcc
agtatgctctcccagtgggaggtgaaccttatggccaaactcagctacctctcggcttct
gagaccagagctctgctgtgcaagtacttcgacaaggtggtgactctgcgtgaggaggag
cgtaagctgcagctggccctggctgagctggagatgcagctggacgagcagcagaagctg
gtgcagtggctggacaacgctctggatcgcacccagctggacaccgaccgccggctcaca
cagcagcagaaggagcacgagaggagtgtgcagctcttactgcagcagtgtcgagaccaa
atagacgagggcctggcaggaaggcagcggcagtatgaaggatggattcataacctcagc
atggagctgaaccactacaaagcagcaaacctggaactaagcaacaaactcagggagctc
tgtggtccaggcagccacccaaaggagcatattaaagcatatgatggaagagcagcaggc
attgacagcatggagaagttgacccgcttccctgaggacagcagcgggggcaggagcccg
gaccaggcctgcaggtcccgggaggagatgcgtgagctggtgaacactcccctcccgtcc
acatggaggcgctcctctctccccacagaggaacctgctgtcatggaggagctgtggctc
caggcagcgggggacgttcctgttaaccgtgtagttcaaactggggcggggtcctggggc
gggccggtcccaatgcctgtggtgaagtctcgcagagagtcgcggcgctccagccttaac
attggaccactgacttccaacaattcattaattgatgtacggaagaatcctgtctga

DBGET integrated database retrieval system