KEGG   Notothenia coriiceps (black rockcod): 104965780
Entry
104965780         CDS       T04920                                 

Gene name
rela
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor p65
  KO
K04735  transcription factor p65
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04137  Mitophagy - animal
ncc04210  Apoptosis
ncc04218  Cellular senescence
ncc04620  Toll-like receptor signaling pathway
ncc04621  NOD-like receptor signaling pathway
ncc04622  RIG-I-like receptor signaling pathway
ncc04623  Cytosolic DNA-sensing pathway
ncc04625  C-type lectin receptor signaling pathway
ncc04920  Adipocytokine signaling pathway
ncc05132  Salmonella infection
ncc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104965780 (rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    104965780 (rela)
  09143 Cell growth and death
   04210 Apoptosis
    104965780 (rela)
   04218 Cellular senescence
    104965780 (rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104965780 (rela)
   04621 NOD-like receptor signaling pathway
    104965780 (rela)
   04622 RIG-I-like receptor signaling pathway
    104965780 (rela)
   04623 Cytosolic DNA-sensing pathway
    104965780 (rela)
   04625 C-type lectin receptor signaling pathway
    104965780 (rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104965780 (rela)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104965780 (rela)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104965780 (rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ncc03000]
    104965780 (rela)
Transcription factors [BR:ncc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    104965780 (rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 104965780
NCBI-ProteinID: XP_010793092
UniProt: A0A6I9PXN0
LinkDB
Position
Unknown
AA seq 660 aa
MDAVYGWGMTPHNQVQAAGPFIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNETTKTHP
AIKVHNYSGPLHVRISLVTKNPPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTNNNPFNIPDAKVWEEEFDLNAVRLCVQATITLPTGDLIPLKPVV
SQPIFDNRAPNTAELKICRVNRNNGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDANLTEPIRVKMQLRRPSDREVSEPMDFQYLPSDPDEYRLN
EKRKRTGDMFQSLKLGPMLSSVSIPQDRRHISPARRTITTKPPSMNAQVAAVVPPGASGA
KHQSSYSYQPGQLFSVQPKMEPVSAATTNQTWKIMESLRLGSQPKATPVPNFTMSQAPSS
CTTSTANQDYSTVNLADLHEFFPNISSAMAQETAASQAGASSSQSSSSFTLQGSHYRVDP
PLVDDDIPEFPSFSEAQPPGVLDNLNMDDFEDLLNPNLMNEGGNVPVMLSSASCQQAHSS
SSAAHAAASQNTSDPAGLPGSTWMNYPNSIVHLLQNEGMIDMSSNNGNHRSTVLDEFDEL
MSADEDRLISILTVEAKLGLCQDTRLKVCPSDFYTDKLRPHVSALQNYKSLVVTKGKRVD
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggacgctgtgtatggttggggtatgaccccgcacaaccaagtccaagcagcgggcccc
ttcatagagatcatcgagcagccgaagcagaggggcatgaggttcaggtataagtgtgag
gggcggtcagctggaagcatccccggagagaagagcaacgaaaccaccaagacccaccca
gccatcaaggtgcacaactacagtggccccctgcatgttcgcatctcattggtgacgaag
aacccaccccacaaacctcacccgcatgaactggtcggaaaagactgcaaacatggctac
tacgaggcagacctgcaggagagaagaatacacagttttcagaacctgggcatacagtgt
gtcaagaagaaggatgtgaatgaagccatcacgtgtcggctgcagaccaacaacaacccc
ttcaacattcccgatgcgaaggtgtgggaggaggaatttgacttgaacgcggtccggctt
tgcgtccaggccaccatcactctgcctactggggatctgattcccctgaagcctgtggta
tcgcagcccatctttgacaacagggcgccaaacacagctgagctgaagatctgccgagtc
aaccgcaacaatggaagctgcaaaggaggggatgaaatatttctactgtgtgacaaagtg
caaaaagaggacatcgaggtgcgcttcttccaggactcctgggagggaaaaggcactttc
tcgcaggctgacgtccacaggcaggtggccattgtgttccgcacaccgccgtaccgcgat
gctaacctcaccgagcccatcagagtcaagatgcagctgcgtcggccctcagaccgcgag
gtcagcgagccaatggacttccagtacctgccctctgacccagatgaatacaggctgaat
gagaagaggaagcgtacaggggacatgttccagagcctgaagctggggcccatgctctct
agtgtgtccattccacaagatagacggcacataagcccggcaaggagaacaatcacaacc
aagcctccatctatgaacgcacaagttgcagctgtggtgccccctggtgccagtggagcc
aaacaccagtcttcctactcatatcaaccgggccagcttttctcagtccagcccaagatg
gagccagtctctgctgcaactacaaaccaaacatggaaaatcatggagagcctgcgcctg
ggctcccaacccaaggccactccagtgcccaacttcacaatgagccaggctccatcctct
tgcaccacgtccaccgccaaccaggactactcaaccgtcaacctggcagacctgcacgag
ttcttccccaacatctcctcggccatggcccaggagacagcagcttctcaggccggcgca
tcctcctcacagagcagcagctccttcaccctgcagggctctcactaccgggtggaccca
ccacttgtggacgatgatatcccagagttcccaagcttttccgaagcccagcctccaggt
gttctggataacctaaacatggacgactttgaggacctcctgaacccgaacctcatgaac
gagggtggaaacgtcccagtcatgctgtcttcagcttcatgccaacaagctcacagctcg
tcttccgctgctcacgccgcagcatcccagaacacatctgaccccgccggcctcccagga
agcacctggatgaattaccccaacagcattgtccacctgctccagaacgagggcatgatt
gacatgtcgtccaacaacggcaaccaccgctcgaccgtgctcgatgagtttgacgagttg
atgtctgcagacgaggatcgtcttatttccattttaacagtggaagccaagctgggtttg
tgtcaggacacccgacttaaagtttgtccaagtgatttttatacggacaaactaagacca
catgtatctgcccttcagaactataagtccttagttgttacaaaaggaaagagggtggat
taa

DBGET integrated database retrieval system