KEGG   Notothenia coriiceps (black rockcod): 104966325Help
Entry
104966325         CDS       T04920                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00052  Galactose metabolism
ncc00500  Starch and sucrose metabolism
ncc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104966325
   00500 Starch and sucrose metabolism
    104966325
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     104966325
    3.2.1.20  alpha-glucosidase
     104966325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 104966325
NCBI-ProteinID: XP_010793815
LinkDB All DBs
Position
Unknown
AA seq 814 aa AA seqDB search
MVCYGRSERGKVPQDPAVFGPGSTLLESSKHYLTIRYTLLPYLYTLFYKAHTTGETVVRP
VMHEFFSDSNTWTVDRQFLWGKHLLITPVLDPGKDRVWAYIPDAVWYNYETMERLTDRRN
HVDMYLPADKLGLHIRGGAILPTQRPDVTTTYSRRHPMGLIVALDDNNQAAGELFWDDGD
SRDTVKTGNHLHYEFSVMAGVLSMQVNRAGYKDPNNLFFENITVLGVAGPPTSVTYTLVG
NSTTAVANVTYDAAKKVLFLTGLSLIVGQSYLVEWEVEPNEHQRFDCYPGENADEAKCRA
RGCIWEPSYIERAPWCFYPKDYGYTMTTSVETNSGMTFDISRNNKYRSNVRPGSPDINTL
RVDIHYHKSDMLQFKIWDPNTERYEVPVPLSVPATPETDETKRLYKVQFTDNPFGIQVIR
KSTGTKIWDSSLPGFTFSEMFIQVSTRLSSEYVYGFGETEHATYRHNLNYHTWGMFAKDQ
PPGYKMNCYGVHPFYMGLEDTADAHGVLLLNSNAMDVTFQPTPSITYRTVGGILDFYMVL
GPTPEMVVQEYTALIGRPVLPAYWSLGFQLCRYGYANDREIADLYRDMRAAGIPYDVQYA
DIDYMERQLDFVLDSEFKGLPALVNTMRDEGMRFIFILDPAISGNEPRGDYPAFDRGLAQ
DVFIKYPKSISDEIVWGKVWPDRPNVTVDESLDWDTQVEIYRANTTFPDFFRKTTAAWWL
QEIKDFYGNIKFDGLWIDMNEPASFVHGTVGENCLGNPLLENPPYMPPLESKHRGLNHKT
LCMNSEQILSDGKRVLHYDVHNLYGWSHTKPTYE
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgctatggaaggagcgagagagggaaggtgccccaggacccagctgtgttcggc
cccggctcaaccctgttggaaagctccaaacattacctgacgatacgttacacactcctg
ccttacctctacacactcttctacaaagcccacaccacgggggagactgttgttcgtcct
gtcatgcacgagttcttctctgacagtaacacctggacggtggaccggcagttcctctgg
ggaaaacacctgctcatcacacctgtactagacccgggtaaggacagggtgtgggcatat
atcccagatgctgtgtggtataactatgagacgatggaacgactgacagaccgcagaaat
cacgttgatatgtacctaccagctgacaagcttggtttacacatcagagggggggcaatc
ctcccaacacagagacctgatgtcaccaccacatacagtcggcgtcatcccatgggattg
attgtcgctctcgatgacaacaaccaggcggctggggagctattctgggacgatggagac
tccagagacacagttaaaacaggcaaccacctccactacgagttctccgttatggctgga
gtgctgtctatgcaggtgaaccgtgctggttacaaggacccaaacaacctcttttttgag
aacatcaccgtccttggtgtggcgggacctcccacgtctgtcacttacactctcgtcgga
aattcaaccaccgcagtagccaacgtcacctacgatgcagccaagaaggtgttgttcctg
accggcctctcgctgattgttgggcagtcgtatctggtggagtgggaagtggagcccaat
gagcaccagcgcttcgactgctatccaggcgagaacgcagatgaggcgaagtgccgagcc
agaggctgcatctgggagccaagctacattgaacgtgctccatggtgcttctatccaaaa
gactatggatacaccatgacgacatcagtagaaacaaactcaggaatgacctttgacatc
tctcggaacaacaagtaccggagcaatgttcgcccagggtctccagacatcaacacactc
cgcgttgacatccattaccacaagagtgacatgctgcagttcaagatctgggacccgaac
acagagcgttacgaggttccagtgccgctgtcggtccccgctactccagagactgacgag
accaaaaggctttacaaggtccaatttaccgataacccgttcggcatccaggtcataagg
aagagcacaggaaccaagatctgggactcctcgctgccaggttttaccttctcagagatg
ttcatccaggtgtcgactcgactgtcatcggagtacgtgtacggcttcggagagacggag
cacgccacctacagacacaacctcaactatcacacctggggaatgttcgccaaagaccag
cctcccggttacaagatgaattgttacggagtgcatcccttctacatgggcctggaggac
actgctgacgctcacggtgtgctgctactcaacagcaatgccatggatgtgactttccag
ccaactccatccataacctatcgcactgtgggcggcatccttgatttctacatggtcctg
ggacctacgcctgaaatggtggtgcaggagtacactgcgctgattggacgacctgttcta
cctgcctactggtcccttgggttccagctctgtcgctatggatacgccaatgaccgggag
atagcagatctttacagagacatgagggcagcgggcataccctatgatgtgcagtatgca
gacattgactacatggagcgtcagctggactttgttctggactcagagtttaaaggactg
cctgccctggtgaacacgatgagggatgaaggcatgaggttcatcttcattctggatcca
gccatctcaggcaatgagcctcgaggcgactaccctgctttcgacagaggtctagcacag
gatgtcttcatcaaatatcccaaaagcatcagtgatgaaattgtgtgggggaaggtgtgg
ccagatagacccaatgtcacagtagatgaatctctggactgggatacccaagtagagatt
tacagagcgaatactacattccctgacttcttccgcaaaacaaccgcagcgtggtggcta
caagaaatcaaggatttctatggaaatataaaatttgacggcctctggattgacatgaat
gagcccgccagttttgtccacggtacagttggagagaactgtcttggtaacccactccta
gagaaccctccatatatgccacctctggagtcgaaacatcgtggtttgaaccacaagact
ctgtgcatgaacagcgagcagatactcagcgatggaaaaagagtccttcactatgacgtc
cacaatctctatggctggtcccacaccaaacccacctatgagtaa

DBGET integrated database retrieval system