KEGG   Notothenia coriiceps (black rockcod): 104966456
Entry
104966456         CDS       T04920                                 

Definition
(RefSeq) uncharacterized protein LOC104966456
  KO
K05461  KIT ligand
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104966456
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104966456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ncc04052]
    104966456
Cytokines and growth factors [BR:ncc04052]
 Growth factors
  Growth factors (RTK binding)
   104966456
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 104966456
NCBI-ProteinID: XP_010793947
UniProt: A0A6I9PZL1
LinkDB
Position
Unknown
AA seq 215 aa
MRKKILKAPCLLLSLFASLNLCSGKFGTPITDDVSKLSLLKQNIPSDYEIPVSYIPKEVA
GTCWVVLNIYPLEQSLRKLANMFGTISSNKENVVVFIAMLKSLRFTFDHEELETAMQLFQ
CHYQEGSLTSGLYFDYIKDVLHAASKGTSGFSCKPPPCLNSQQKPGGQREGRKYSWSNRY
PLLLALIPFTACVVIIVWLVSNYSEWISYFMKREN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcttgaaagcaccttgtctcctcttgagtctgttcgcaagtttaaat
ctctgctccggaaaatttgggacgccgattactgacgatgtgagcaagctatcattattg
aagcagaatatcccctctgattatgagattcctgttagttacattcccaaagaagtggct
ggcacgtgctgggtcgtgttgaacatctatcctttggagcagagtctaaggaagctagcc
aacatgtttggcaccatttcctccaacaaagaaaacgtagtcgtcttcatcgcgatgctg
aagagtttacgcttcacctttgaccatgaggagctcgaaactgcgatgcaactcttccag
tgtcactatcaggaagggagcttgacgtcgggcctttactttgactacatcaaagacgtc
ttacatgcggcctccaaaggaacatccggtttctcgtgcaagccaccaccatgccttaat
tcacaacaaaaaccaggtggtcagcgggagggtcgtaagtacagctggtccaacagatat
ccactgcttctggctctcatccccttcacagcttgtgttgtcatcatagtgtggctggtg
agtaattattcggagtggattagctactttatgaaacgtgaaaattag

DBGET integrated database retrieval system