KEGG   Notothenia coriiceps (black rockcod): 104967413
Entry
104967413         CDS       T04920                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04068  FoxO signaling pathway
ncc04110  Cell cycle
ncc04115  p53 signaling pathway
ncc04218  Cellular senescence
ncc04310  Wnt signaling pathway
ncc04340  Hedgehog signaling pathway
ncc04371  Apelin signaling pathway
ncc04510  Focal adhesion
ncc04530  Tight junction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104967413
   04340 Hedgehog signaling pathway
    104967413
   04371 Apelin signaling pathway
    104967413
   04068 FoxO signaling pathway
    104967413
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104967413
   04115 p53 signaling pathway
    104967413
   04218 Cellular senescence
    104967413
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104967413
   04530 Tight junction
    104967413
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104967413
NCBI-ProteinID: XP_010795159
UniProt: A0A6I9PW22
LinkDB
Position
Unknown
AA seq 213 aa
MNYMDRFLSVEPTKKSHLQQLGAVCMFLASKLKETMPLSAEKLCIYTDNSITTTQLLQME
LLVLNKLKWDLASVTPLDFLDHFLSQLAVRRENRPILRKHAQTFVALCATDVKFIASPPS
MIAAGSMVAAVEGLQMRMVGNSLMSQKLTEQLAQTIRSDPDCLRACQEQIEVLLETSLRL
AQQPQHTVAMETKNISEEQDLSTTPTDVRDINI
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaactacatggaccgcttcctgtctgtggaacccaccaagaagagccacctgcagcag
ctgggggccgtctgcatgttcctggcatccaaactgaaggagacaatgccactcagtgcc
gagaaactctgcatctacaccgacaactccatcacaaccacccagctgctgcaaatggag
ctgctggttctgaataagctgaagtgggacctggcttcagtgaccccccttgacttcctc
gaccacttcctgtctcagctggctgtcaggagagagaacaggcccatcctcaggaagcac
gctcagaccttcgtggctctgtgtgccacagatgtgaagtttattgccagccccccctcc
atgatagcagcaggcagcatggtggcagcggtggaggggctccagatgaggatggtgggc
aacagcttgatgtctcagaaactgacagagcagctggcacagaccatcaggagtgacccg
gactgtctcagggcgtgtcaggaacaaatcgaggtgctgctggaaaccagcctcagactg
gcacaacaaccccaacacacagttgccatggaaactaagaacatcagcgaggagcaggac
ctctcaacgacacccacagatgtccgggacatcaacatctga

DBGET integrated database retrieval system