KEGG   Notothenia coriiceps (black rockcod): 104967512
Entry
104967512         CDS       T04920                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
ncc  Notothenia coriiceps (black rockcod)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Imm58
Other DBs
NCBI-GeneID: 104967512
NCBI-ProteinID: XP_010795292
UniProt: A0A6I9Q2P0
LinkDB
Position
Unknown
AA seq 356 aa
MSKCELIELKDLSANDTIELAAPAAPTAPPSVNPGQPSHVVRLVGDSVSIEAPRGQMGRA
GVGHDFHPYSHTHLTWCDQCGEFIWGIYKQSLRCANCSYTCHHRCRLFIQLDCSTDGSLL
PDEEDFSVDSLETDTNVDELIDSGKQELTPSEIQHKIKEYNAQINSNLYMVANKDGSYTG
FIKVHFQLVRPISLPPAENSCSTQEEDQQGRRMKRRTSFYLPKDTAKHLHISSQTRVREV
IEALLNKFTVVDNPAKFALFERSERHSQVYMRKLPNDERPLHLRLCAGPSEKVLTLILKE
NETGEVNWDAFSLPELCNFLRILKREEEEHVRQIERRYARTRETTKQAMERITTPG
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagttgattgaactgaaggacctcagtgcaaatgataccattgagctg
gctgctcctgcggccccaacggccccgccctctgtaaacccaggtcagccgagccatgtg
gtccgtctggtcggagacagtgtcagcatcgaggccccccggggtcagatgggacgagct
ggagtgggtcatgacttccatccatacagtcacacccatctcacctggtgtgaccagtgt
ggagaattcatctggggcatctataagcaaagtttacgctgtgccaactgcagttacact
tgtcaccaccgctgccgactatttatccagctggactgcagcacagatggaagtttgtta
ccagacgaggaagatttctctgtggactccctcgaaacagatacgaatgtggatgagctg
atcgattcgggtaaacaggagctgacgcccagtgagattcaacataagattaaagagtat
aatgcacagatcaacagcaatctctacatggtggctaataaagatgggtcctacactgga
ttcatcaaggtccactttcagttagtccgtcctatctccctccctcctgctgagaactcg
tgctcaacacaggaggaagatcagcagggccgacggatgaaacggcggacatctttctac
ctccctaaagacactgccaagcacctgcatataagctcccaaacacgagtgcgagaagtc
atcgaggcactactcaacaagtttactgtggtggacaacccggccaagtttgccctgttt
gaacgctcagagagacatagtcaagtgtacatgcgtaaactgcctaatgatgagcgcccc
ctccacctgcgcctgtgtgctggccccagtgaaaaggtcttgacccttatattgaaggag
aatgagacaggggaagtaaattgggatgcatttagtttacctgagttgtgcaactttctg
cgaatcctgaagcgtgaagaggaagaacatgtgcggcagattgagaggcgctacgctcgc
actagggaaaccacgaagcaggcgatggaaaggattacgactcctggttga

DBGET integrated database retrieval system