KEGG   Notothenia coriiceps (black rockcod): 104967780Help
Entry
104967780         CDS       T04920                                 

Definition
(RefSeq) trypsin-2-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104967780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ncc01002]
    104967780
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ncc04147]
    104967780
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     104967780
Peptidases and inhibitors [BR:ncc01002]
 Serine peptidases
  Family S1: chymotrypsin family
   104967780
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104967780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 104967780
NCBI-ProteinID: XP_010795607
LinkDB All DBs
Position
Unknown
AA seq 179 aa AA seqDB search
MCVFSVATEEDKIVGGKECTPYSMPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEV
RMGEHHIRVTEGNEQFISSSRVIRHPNYSSYNINNDIMLIKLSKPATLNQYVQAVALPSS
CAPAGTMCTVSGWGSTQSSSADGNKLQCLNIPILSDRDCDNSYPGQITDAMFCAGYLEG
NT seq 538 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgttttctcagttgccacggaggaggacaagatcgtcggagggaaggagtgcact
ccatactccatgccccatcaggtgtctctgaactctggctaccacttctgtggaggctcc
ctggtcaacgagaactgggtggtgtctgctgctcactgctacaagtcccgtgtggaggtt
cgtatgggagagcaccacatcagggtcaccgagggaaacgagcagttcatcagctcctcc
cgtgtcatccgtcaccccaactacagctcctacaacatcaacaatgacatcatgctgatc
aagctgagcaagcccgccaccctcaaccagtacgttcaggccgtggctctgcccagcagc
tgtgcccccgctggcaccatgtgcaccgtctccggctggggaagcacccagagctcctct
gctgacggcaacaagctgcagtgcctgaacatccccatcctgtccgacagggactgtgat
aactcttaccccggtcagatcactgatgccatgttctgcgctggataccttgagggag

DBGET integrated database retrieval system