KEGG   Nosema ceranae: NCER_101591Help
Entry
NCER_101591       CDS       T01614                                 

Definition
(GenBank) hypothetical protein
Organism
nce  Nosema ceranae
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR_C
Motif
Other DBs
NCBI-ProteinID: EEQ81822
UniProt: C4VAD0
LinkDB All DBs
AA seq 456 aa AA seqDB search
MRNLKILNAALLCVPKILANICAPNQGKPGIMIMNPGQLENCATPNKPLIYNPPAGQQGR
PGSDCIVGGGQGGYPSHGGLPSQNGSMPQICTSGNYPGSNMPGGNYPGSNMPGGNYPGGN
MPGGQNLIPGQGIPTAPGGQYPMVPGQGILTMPGQYTMVPQQPPQYVPVVPVVPAAPVQS
AVPAPAYPPSAPQPPNVTQIIQSTPPPATTIIQPTTPQAPSTNVPAQPTKPPGQETQCTV
KQTVDCVPINPEEEVPEVPTTPGETTNPNNPQGNNPPAQTIVHVTPAPTTPPMPPQYSPQ
PCIPQQVNPPSNNTGASNLPYCIPNNSTGSPSYSQQGTPQGTPNGLPQGPVNAIYVPTVI
SPPASAPTTDCASPANLINSLCDTAAQQGQSMGYKGGNCDVQSNIECLNKMINSPPQASP
YDAMECVTPQKPMVDVGVLVPASDAYLQAHQNVCVQ
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttaaagattttaaatgcagctctattgtgtgtgccaaagattttggctaac
atatgtgcccctaatcaaggaaaaccaggaattatgattatgaacccaggccagctagaa
aattgtgcgactcccaataaaccattaatttataaccctcccgcaggacaacaaggaaga
cctggaagtgattgtattgtaggcggaggacaaggtggatacccatctcatggcggttta
ccatctcaaaacggttcaatgccacaaatttgtacaagtggaaattatccaggaagcaat
atgccaggtggaaattatccaggaagcaatatgccaggtggaaattatccaggaggcaat
atgccaggaggacaaaacttgatacccggccaaggaatcccaacagcaccaggaggtcaa
tatcctatggtacccggccaaggaattctaacaatgccaggccagtatactatggtaccc
cagcaaccaccacaatatgtgccagtagtcccagtagtacctgctgctcctgtacaatca
gcggttcctgcccccgcatatccccccagtgcacctcagccacctaatgttactcaaata
attcaatccacaccaccaccagccaccacaattatacaaccaacaactcctcaagctcct
tctacaaatgtgcctgcacaaccaactaaaccgccaggacaagaaactcagtgtactgtc
aaacagactgtcgattgtgtacctattaatcctgaagaagaagttcctgaagtgccaact
acacctggtgaaaccactaatccaaataatcctcaaggaaacaatccaccggctcaaaca
attgttcatgtcacgcccgctccaacaactccaccaatgcctcctcaatattcccctcaa
ccatgtatacctcagcaagttaatccaccttctaacaatacaggcgcctcaaatttacca
tattgtattccaaataactcaacaggatcaccctcttattcacaacagggaacaccacaa
ggaacacctaatggattacctcaaggacctgtcaatgctatctatgtaccaactgtaatt
tcaccgcctgcttcagctccaacaactgattgtgcatctccagcaaatttgattaattct
ttatgtgatactgcagctcaacaaggacaatcaatgggatataaaggaggtaattgtgat
gttcaaagtaatatcgagtgtcttaataaaatgataaattctcccccacaagcttcaccc
tatgatgctatggaatgtgttactcctcaaaaaccaatggtcgatgtaggtgtattagta
cccgcctctgatgcttatttacaagcacaccagaatgtatgcgtacaataa

DBGET integrated database retrieval system