KEGG   Neoasaia chiangmaiensis: A0U93_01940Help
Entry
A0U93_01940       CDS       T04705                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
nch  Neoasaia chiangmaiensis
Brite
KEGG Orthology (KO) [BR:nch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A0U93_01940
Enzymes [BR:nch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     A0U93_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AQS86909
UniProt: A0A1U9KM94
LinkDB All DBs
Position
412121..413140
Genome map
AA seq 339 aa AA seqDB search
MLAIVIHGPRDLRIETMETGELKAGQVLIRIEAGGICGSDLHYYQHGGFGSVRIREPMIL
GHEIAGRVAQIAPDVTTLKVGDMVAVNPSSPCGKCEMCLKGLSNHCVNMRFYGSAMRMPH
VQGGFRDKLICDATQCFPAKRMDASALALAEPFAVALHAVKRAGSLLNKRVLVTGCGPIG
ALVVAAARLHGAREIIATDVVPEPLAVVRTLGADRTIDVRDRPDSLTALAGKLDVMFECS
ANERAFHTGMDTLQPQGIIVQVGLGGDVPLPQAQLASRELSLRGSFRFDDEFGLAVALID
SGRAVLDTLISRHFPMHDAVSAFELASDRRAAMKVQLAF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgatcgtcattcatggcccccgcgatctgcgtatcgaaacaatggaaaccggc
gaactcaaagccgggcaggtgctgatccgcatcgaagctggcggcatctgtgggtccgat
ctgcactattatcagcacggcggcttcggaagcgtacgcattcgcgaacccatgattctc
gggcatgagatcgccggtcgcgttgcgcagattgcaccggatgtcacgacgctcaaggtt
ggcgatatggtcgccgtcaacccaagcagcccatgtggcaaatgtgagatgtgcctgaag
ggcctgtccaatcactgcgtcaacatgcgattctatggtagcgcgatgagaatgccgcat
gtgcaaggcgggttccgcgacaagctgatctgcgacgccacccagtgcttcccggccaag
cgcatggatgcttcggcgctcgcgctggcggaaccgtttgcagtggcattacacgcggtc
aagcgcgccgggagcctgctgaacaaacgtgtcctggtgacgggttgtggaccgatcggt
gcactggtcgtcgctgccgcgcgtctgcacggtgcgcgggaaatcattgccaccgatgtc
gtgcccgaaccgttggccgtggttcggacattgggcgccgatcggacgatcgatgtgcgt
gatcgaccggatagcctgacggcactggcgggtaagctggatgtcatgttcgagtgttcg
gccaatgaaagggctttccacacgggtatggatacgcttcagccgcagggtatcattgtg
caggtcggtctgggtggcgatgtgccactcccgcaggcacagcttgcatcacgggaactg
tctttgcgtggctcattccgtttcgacgatgaattcggacttgccgtggcgctgatcgat
tccgggcgcgcggtgctggacacgctgatcagcaggcatttcccaatgcatgacgccgtc
tcggctttcgaactcgcatctgatcggcgtgctgccatgaaagtccagctggcgttctga

DBGET integrated database retrieval system