KEGG   Neoasaia chiangmaiensis: A0U93_13950Help
Entry
A0U93_13950       CDS       T04705                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
nch  Neoasaia chiangmaiensis
Brite
KEGG Orthology (KO) [BR:nch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A0U93_13950
Enzymes [BR:nch01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A0U93_13950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA Glutaredoxin FAD_binding_3 AlaDh_PNT_C FAD_binding_2 DAO FAD_oxidored NAD_binding_8 Thi4 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AQS88843
UniProt: A0A1U9KSN3
LinkDB All DBs
Position
2974241..2975824
Genome map
AA seq 527 aa AA seqDB search
MLQDNIKEQLRGYLANLKHPIVLDVALDDSAKSREMDELLRDIAALSDKVRVSELREAAR
RPSFLVRREDESVGVTFAGIPMGHEFTSLILALLQVGGHPPKLSDDLVAQIRDLPGTYEF
ETFISLSCQNCPDVVQALNAMSVINPNIRHTMIDGALFQDEVTAKQIMSVPQVFLNGQSF
GSGRMDAEAILAKIDTGATARAAAKIGEKAPFEVLIVGAGPAGAASAVYAARKGIRTGIL
GERFGGQVLDTMAIENFISVPETEGPKLAAALERHVREYEVDVTTGQRAKALIPASEPGG
LHEIQLESGASLHSRSLILAPGARWRHMNVPGEDAYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVQHVTLLEFADKLRADEVLQAKLRSLPNVKIVTRALTTEVVGDG
QKVTRLLYRDRQTEAEHEIALEGIFVQIGLVPNTEWLRDTIALTERGEIEVDAHGATSVP
GVFAAGDATTTPYKQIIIATGEGAKAALSAFDYLIRLPVPAEARQAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagacaatatcaaggaacaactgcgcggttatctggccaatctgaagcatccg
atcgtgctcgacgtggctttggacgacagcgccaaatcgcgcgagatggacgaactgctg
cgcgatatcgccgcactgtcagacaaggtgcgcgtgtcggaattgcgcgaggcggcgcgt
cgcccgtctttcctcgtgcgccgggaggacgaaagcgtcggcgtgacattcgccggcatc
ccgatgggccatgaattcacgtcgctgatcctggcgctgcttcaggtcggtggtcacccg
ccgaaactgtcggacgatctggtcgcccagatcagggatctgcccgggacctatgagttc
gagacgttcatctcgctttcctgccagaattgcccggatgtcgtgcaggcgctcaatgcg
atgagcgtcatcaacccgaacatccgtcatacgatgatcgacggtgccctgtttcaggac
gaggtaacggcgaagcagatcatgtccgtcccgcaggtgttcctgaacggtcagtccttc
gggtctggccggatggacgccgaggcgattcttgccaagatcgacacgggcgcgacagca
cgggcggcggcaaaaatcggcgagaaggcaccgttcgaggtgttgatcgtcggtgcggga
ccggcgggtgccgcgtccgcggtctatgccgcgcgcaaggggatccgcaccggcattctg
ggcgagcgcttcggcgggcaggtgctcgataccatggccatcgagaatttcatctcggtg
ccggagacggaagggccgaagctggccgcggcactcgaacgccacgttcgtgaatatgag
gtggacgtcacaacgggccagcgcgccaaagccctcatcccggcatccgaaccgggtgga
ttgcatgagattcagctggaaagcggcgcttccctacattcgcgttcgctgatcctggcg
ccgggcgcgcgctggcggcatatgaacgtgccgggcgaagacgcctatcgcaacaagggc
gtggcctattgtccgcattgcgacggcccgttgttcaagggcaagcgtgttgccgtgatc
ggcggtggcaatagcggcgtggaagcggccatcgatctggcggggatcgtccagcacgtt
accctgctggagttcgcggacaaacttcgggccgatgaggtgcttcaggcgaagctgcgg
agcctgccgaatgtgaagatcgtgacccgcgccctgaccaccgaggtcgtgggcgatggg
cagaaggtcacgcgccttctgtatcgtgaccggcagaccgaggccgagcatgaaatcgcg
ctggaaggcattttcgtccagatcggtctggtgccgaacacggaatggctgcgtgacacg
attgccctgaccgaacgtggcgagatcgaagtggacgcacatggtgccacgtcggtaccc
ggcgttttcgcggcgggcgatgcgaccaccacgccctacaagcagatcatcatcgcaacg
ggcgagggggcgaaagcggcattgtcggccttcgattacctgatccgtctgccggttcct
gccgaagcgcgtcaggccgcctga

DBGET integrated database retrieval system