KEGG   Neoasaia chiangmaiensis: A0U93_14565Help
Entry
A0U93_14565       CDS       T04705                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nch  Neoasaia chiangmaiensis
Pathway
nch00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nch00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A0U93_14565
Enzymes [BR:nch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A0U93_14565
Transporters [BR:nch02000]
 Other Transporters
  Pores ion channels [TC:1]
   A0U93_14565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AQS89578
UniProt: A0A1U9KUP9
LinkDB All DBs
Position
3120311..3120979
Genome map
AA seq 222 aa AA seqDB search
MRILYHLPLSPQSRQVRLVLGEKRLPYEPMTERVWERRTEFLAMNPAGDVPLLVEENGLT
IPNAGVICEYLEEAYPDTPLMGRTLAERAEVRRLMAWFNEKFAQEVSRNLLGEKVDKRLS
GRGNPDGNALRAGYANIRFHLDYIGWLAETRAWLAGGMLSMADFAAAAHLSCLDFIGDID
WSKAPAVKDWYARVKSRPCFRALLNDRVTGFTPPDHYADLDF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattctctatcatttgcccctttctccgcaaagtcgtcaggttcggctcgttctt
ggcgagaagcgactgccctatgaaccaatgacggaacgcgtctgggaacgtcgcacagag
tttctggcgatgaatcctgcgggcgacgtgcccctgctggtcgaggagaacggactgacg
atcccgaatgccggggttatttgcgagtatctcgaggaagcctatccggatacgccgctc
atgggccggacccttgccgagcgcgcggaggtgcggcggttgatggcgtggttcaacgag
aagttcgctcaggaggtgtcgcgcaatctcctgggggaaaaagtggacaagcggctctcg
ggccggggcaatcctgatggcaatgccctgcgggccggatatgcgaatatccgttttcat
ctggattatatcggctggctggccgagacgcgcgcctggctggcgggcgggatgctgtcc
atggcggatttcgccgccgccgcacacctgtcatgcctggatttcattggcgatatcgac
tggtcgaaagcaccggccgtcaaggactggtatgcacgggtcaagtcaagaccgtgtttc
agggcgcttctcaatgaccgggtaacgggcttcacgccgccggaccattacgccgatctc
gatttctga

DBGET integrated database retrieval system