KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_02225Help
Entry
BZZ01_02225       CDS       T04905                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
ncn  Nostocales cyanobacterium HT-58-2
Pathway
ncn00910  Nitrogen metabolism
ncn02010  ABC transporters
Module
ncn_M00438  Nitrate/nitrite transport system
ncn_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ncn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BZZ01_02225
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BZZ01_02225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ncn02000]
    BZZ01_02225
Transporters [BR:ncn02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BZZ01_02225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 TrbE DUF4519
Motif
Other DBs
NCBI-ProteinID: ARV57604
UniProt: A0A1Y0RCD5
LinkDB All DBs
Position
complement(538721..539560)
Genome map
AA seq 279 aa AA seqDB search
MTAIVGSRIGRKKSQKAINKLFWKKVVPPLVALAIFLVIWQLLCLNPNFKLPGPLETFSE
TWDPFIINPFFDNGESDKGLGWQILSSLGRVGLGFSLAAIVGIALGILIGANQLLYNAVD
PIFQVLRTVPPLAWLPISLAAFQQANPSAIFVIFITSIWPIIINTIVGVQQIPQDYINVA
RVLRLKGPKYFLKVVFPATVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGSFIWDAYNT
TTETNLSEIILALIYVGLVGLMLDRLVAFIASKVVAEQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacagctattgtggggagtcgtattggtagaaaaaaatctcaaaaagcgataaataaa
ttattctggaaaaaagttgtgcctccactcgtcgcattagctatttttctagttatttgg
caattactttgtttaaatcctaactttaagttacccggaccgctagaaacattttctgaa
acttgggacccttttatcatcaatccattttttgataacggcgaaagtgataaaggttta
ggctggcaaatccttagtagtttgggacgtgtcggtttaggcttttcgctagctgcaatt
gtaggaattgcattgggaatcttgattggtgctaatcagttactctataacgccgtagat
cccattttccaagttttgcggactgtaccgcctctagcatggctaccaatttcgctggca
gcgtttcaacaagccaatccttcagcgattttcgtgatttttattacatctatttggcca
ataatcatcaacaccatagtaggtgtacaacaaatccctcaagactacataaatgtcgct
agagttttacgactcaaaggaccaaagtatttcttgaaagttgtgtttcccgccactgtt
ccttacatattcaccggcttacgaattggcattggtttatcttggttagcgattgttgct
gcggaaatgttagttggcggtgtgggaattggttcatttatttgggatgcctacaacacc
acgacagagactaatctgagcgagattatcctagcactcatatatgtcggtttagttggc
ttgatgttagatagattggttgcttttatagctagcaaagtcgtagcagaacaaaagtag

DBGET integrated database retrieval system