KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_04625Help
Entry
BZZ01_04625       CDS       T04905                                 

Definition
(GenBank) AMP-dependent synthetase
Organism
ncn  Nostocales cyanobacterium HT-58-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ANF_receptor
Motif
Other DBs
NCBI-ProteinID: ARV58014
UniProt: A0A1Y0RDI0
LinkDB All DBs
Position
1094895..1096742
Genome map
AA seq 615 aa AA seqDB search
MEVHYMRTDFKPLLTKHHFSTLVELLSYRASIQSEQKAYTFLQNSETEAESLTYEALHLQ
AQAIAARLQSLDAFGERALLLYQPGLDFIAAFFGCLYAGVVAVPAYPPRRNQSLSRLQAI
AQDAQAKVVLTSTKLLSSLQSSSIQEGLELAGLHWLATDGLSTDIASNWQPQELDSDTLA
FLQYTSGSTGTPKGVMISHGNLLHNEQTIQKAFGHTEKTIGMGWLPVFHDMGLIGNVLQP
LYLGFHCILMSPVDFLQKPIRWLQTISKYKATTSGGPNFAYDLCIRKVTPEQLNNLDLSS
WEVAFTGAEPVRAATLEEFAFKFAPCGFRKEAFYPCYGMAETTLIVTGGQKTALPITCNV
EKAALEQNRIVKAHTTNEDTQTIVGCGQSPSDQKVVIVDPQSLTLCTPEQIGEIWVAGPS
VAQGYWNQTQETEKTFRAYLADIGEGPFLRTGDLGFLQDGELFITGRLKDVIIIRGQNHY
PQDIELTVEKSHPSLRAGCGAAFAIDFQGSERLVIVQEVERSYLRKLNVQEVVGQIRQKI
AAQHGLEVYATVLVKTGSIPKTSSGKIRRRACRDEFLSGSLDVVEDWSENPQNKAKFIHL
QADLDSMLEQLTSTK
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgcattatatgaggaccgattttaagcctttgctaactaaacaccatttttca
acactcgttgaattgctaagttatagagctagtattcagtctgagcagaaagcttatact
tttttacaaaatagtgaaacagaagcagaatcgctaacttatgaagctttacatttgcaa
gcacaggcaatcgcggctaggcttcaatctttagatgcctttggtgaaagagccttatta
ctctatcaaccaggtctagattttattgctgccttctttggatgtctatatgcaggtgtt
gttgctgttcctgcttatccacccagacgaaatcaaagtctttctagattgcaagcgatc
gcccaagatgctcaagcaaaggtagtactaacctctacaaaattgctctctagcctccag
tctagttccattcaagagggtctagaactcgctggattacattggttagctaccgatgga
ttgagtactgatatagcatcaaactggcaaccccaggaactagatagtgataccttggct
ttcttacaatacacatctggctccacaggcacgccaaaaggagtgatgattagtcatggg
aatctgttgcataacgagcaaacgatccagaaagccttcggacatacagagaaaactatt
ggtatgggttggttacctgtattccatgacatgggactgattggaaatgttttacaacct
ttatatttggggtttcattgcattctgatgtccccagtagattttctccaaaagccaatc
cgttggttacagactatatcaaaatacaaagcgacaactagtggtggaccaaattttgct
tatgatctttgcattcgcaaagtcacaccagaacagttgaacaatctcgatctcagcagt
tgggaagttgcttttacgggtgccgaacctgtacgcgctgcaactttagaagagtttgct
tttaaatttgcaccttgtggtttccgcaaagaagcattttacccttgttacggtatggca
gaaaccactctcatagtaactgggggccagaaaacagctttaccaatcacttgtaatgtg
gaaaaagcagccttagagcaaaaccgaattgtcaaagcgcacacaactaatgaagataca
cagacaatagtaggttgtggacaaagcccttcagatcaaaaggttgtcattgttgatccc
caatctttaactctgtgtactcctgagcaaatcggtgaaatttgggtagctggtccgagt
gttgctcaaggttattggaaccagacacaagagacagaaaaaaccttccgtgcctattta
gcagatatcggcgaaggtccatttcttcgcactggagacttaggatttttgcaagatggg
gagttatttatcacaggacgactgaaagatgtaatcatcatcagagggcaaaatcattat
ccccaagatattgaactgactgtagaaaaaagtcatccgtctctacgcgcaggttgcggg
gcagcatttgccattgatttccagggttctgaacgattagttattgttcaggaggtagaa
cggagttacttgcgaaagttaaacgttcaagaagtcgttggacaaattagacaaaaaata
gccgcacagcatgggttggaagtttatgctaccgtactcgtgaagactggcagtattccc
aagacttctagtggtaaaattcgccgtcgagcctgtcgagatgagtttctttctggaagt
ttagatgtggtagaagattggagtgaaaatcctcaaaataaagcaaagtttatccattta
caagctgaccttgattctatgctagaacaactcacatctactaaatag

DBGET integrated database retrieval system