KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_06795Help
Entry
BZZ01_06795       CDS       T04905                                 

Definition
(GenBank) glutathione S-transferase
Organism
ncn  Nostocales cyanobacterium HT-58-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: ARV58384
UniProt: A0A1Y0REL0
LinkDB All DBs
Position
1611815..1612498
Genome map
AA seq 227 aa AA seqDB search
MSTLQLYFAKGSTFSQRTRVVLLEKGIDFTPIEIDLQNKPEGYTQISRYGKVPAIKHGNI
EIYESAIINEYLDEVFPEPPLLPRDPGAKAIARIWIDYANTRFVPAFNKFLRGKDTQEQE
QGRREFLESLLYIEQEGLGKLSGNGPYWLGEKLSLVDISFYPWFERLPLLEHFRKFTLPS
ETSRLQQWWNIVRERESVRAVENPVSFYIERFAKILGEPTSVGAVQK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagtactttacaactttacttcgcaaaaggctctaccttctcccaacggacccgtgtt
gttttgctagaaaaaggaattgactttaccccgattgaaattgacttacagaacaaaccg
gaagggtacacgcagatttcacgctatggcaaagttcctgccataaaacatgggaatatc
gagatttatgagtctgctatcatcaatgaatatctcgatgaagtcttcccggaaccgcct
ttattgccacgtgatccaggagctaaggcgatcgctcgcatctggatagactacgccaac
actcgctttgtcccagcgtttaacaaattcttgcgcggtaaagatacgcaggaacaagaa
caggggcgcagagagtttttagaatcccttttgtacattgagcaagaaggattaggcaag
ctgtccggtaatggtccatattggttaggggagaagttgagtttagtcgatatcagtttc
tatccctggtttgaacgcttgcctcttctggaacacttccgcaaatttacgctaccatca
gaaacatcccgcttgcagcaatggtggaatattgtgcgagagcgagagtcagtccgggca
gttgaaaatcctgtgagcttctatatagaacgattcgctaagattcttggtgaacccacg
agtgtgggtgctgttcaaaagtag

DBGET integrated database retrieval system