KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_17925Help
Entry
BZZ01_17925       CDS       T04905                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ncn  Nostocales cyanobacterium HT-58-2
Pathway
ncn00010  Glycolysis / Gluconeogenesis
ncn00053  Ascorbate and aldarate metabolism
ncn00071  Fatty acid degradation
ncn00280  Valine, leucine and isoleucine degradation
ncn00310  Lysine degradation
ncn00330  Arginine and proline metabolism
ncn00340  Histidine metabolism
ncn00380  Tryptophan metabolism
ncn00410  beta-Alanine metabolism
ncn00561  Glycerolipid metabolism
ncn00620  Pyruvate metabolism
ncn00625  Chloroalkane and chloroalkene degradation
ncn01100  Metabolic pathways
ncn01110  Biosynthesis of secondary metabolites
ncn01120  Microbial metabolism in diverse environments
ncn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ncn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BZZ01_17925
   00053 Ascorbate and aldarate metabolism
    BZZ01_17925
   00620 Pyruvate metabolism
    BZZ01_17925
  Lipid metabolism
   00071 Fatty acid degradation
    BZZ01_17925
   00561 Glycerolipid metabolism
    BZZ01_17925
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BZZ01_17925
   00310 Lysine degradation
    BZZ01_17925
   00330 Arginine and proline metabolism
    BZZ01_17925
   00340 Histidine metabolism
    BZZ01_17925
   00380 Tryptophan metabolism
    BZZ01_17925
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BZZ01_17925
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BZZ01_17925
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BZZ01_17925
Enzymes [BR:ncn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BZZ01_17925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh NYD-SP28
Motif
Other DBs
NCBI-ProteinID: ARV60261
UniProt: A0A1Y0RNF8
LinkDB All DBs
Position
4434605..4435984
Genome map
AA seq 459 aa AA seqDB search
MIAQELSIVDIIRKQRDFFKTGKTKDVNFRLEQLKILKQAVSENKEAIIQALKADLNKPE
FESYATEIGTLQEIDYAIKHIKTWTKPQKAPVSLQLFPASAKIYPEPLGVVLIIGPWNYP
FQLSISPLVGAISAGNCAIVKPSELAPHTSHLLSKLLGKYFDPAYIAVVEGGVQTSQQLL
AEKFDHIFFTGGTAVGKIVMEAAAKNLTPVTLELGGKSPCIVDSDINIEPTARRITWGKF
LNAGQTCIAPDYLLVDKKIKEDFLNEIQKCLQEFYGDNPASGSDYARIINQKQFNRLVNF
LKDGEIRIGGETNPSELYIAPTVLENVSSTAPVMQEEIFGPILPVIEYTDITEAIDLINS
KPKPLALYLFSNNKNLQQRILQETSSGGVAINDTVMQVAVSSLPFGGVGDSGIGKYHGKS
SFDTFSHYKSVLHNPFWLDLKWRYAPYKDKLSTLKRLIG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgattgctcaagaattatcaattgtcgatatcatccgcaaacaacgtgacttttttaaa
actggtaagacaaaagacgttaattttcgacttgaacaactaaagattctcaaacaagca
gtcagtgagaataaagaagcaattattcaagccctgaaagctgatttgaataaaccagaa
tttgagagctatgcaacagaaattggtacactccaagaaattgactatgctatcaaacat
atcaaaacttggactaaacctcagaaagcgccagtttctctacaactatttcccgcttca
gcaaaaatttatcctgaaccgctaggagtcgttttaattattggtccttggaactatcca
tttcaattaagtatttcaccattggtaggtgctattagtgcaggtaactgtgcaattgtc
aaaccttcagaattagcaccgcatacctctcatcttcttagcaagctattaggaaaatat
ttcgatccggcgtatattgctgtggtagaaggaggtgtgcaaacaagtcaacaactccta
gcagaaaagtttgaccatatctttttcactggtggcacggctgtgggcaaaatagttatg
gaagccgctgcaaaaaatcttacgcctgtcaccttggaattaggcgggaaaagtccttgc
attgtagattcagatattaatattgaacctaccgccagacgcattacttggggtaaattt
ctcaatgctgggcaaacttgtattgcacctgactatcttttggtagataaaaaaatcaaa
gaagattttttaaatgaaattcaaaaatgtctgcaagaattttatggagataatcccgcc
agtggttctgattacgctaggattatcaatcaaaaacaattcaataggttagttaacttc
ctaaaagatggcgaaatccgcattgggggagagactaacccttcagaactttatattgcc
cctacggtgcttgaaaatgtctcctcaacagcccctgtcatgcaggaagaaatttttggt
ccgattcttcctgtgattgaatatactgatatcacagaagcaattgacttaatcaactct
aaaccaaaacctttagctttgtacttattttccaataacaaaaacctgcaacaacgaatc
ttgcaggaaacctcatctggtggagttgctatcaatgacaccgtgatgcaggttgctgtt
tcatctttaccattcggcggtgtgggtgatagcggaattggcaagtatcacggtaaatcc
agcttcgacaccttttcccattacaaaagtgtcttgcacaatcctttctggctagattta
aaatggcgatacgctccctataaagacaagttgtctacactgaagcgacttattggttaa

DBGET integrated database retrieval system