KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_18905Help
Entry
BZZ01_18905       CDS       T04905                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ncn  Nostocales cyanobacterium HT-58-2
Pathway
ncn00040  Pentose and glucuronate interconversions
ncn00051  Fructose and mannose metabolism
ncn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BZZ01_18905
   00051 Fructose and mannose metabolism
    BZZ01_18905
Enzymes [BR:ncn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BZZ01_18905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C CoA_binding ADH_zinc_N_2 Cas_csx3 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ARV60425
UniProt: A0A1Y0RN98
LinkDB All DBs
Position
complement(4673487..4674533)
Genome map
AA seq 348 aa AA seqDB search
MKAQVFRGVNQLSYENIPVPTLEPDEVLVQVQVVGLCQSDIKKIRYPLYEPPRIFGHETA
GTISAVGSEVKGWQVGQRVAVMHHIPCMRCAYCLNDNFSMCDVYKNISTTAGFNASGGGF
AEYVKVPGHIVRNGGLIPIPDNISFEEASFVEPTNCCLKAVKKARIAPGQTVLITGAGPI
GLMFIMLVKYFGAKAIATDLLPSRIEKALNVGAEAAFDARDANLPAKIHELTNGMGVDVA
LLAVPSEKAFFQALDCTRKGGKILFFAEFPDEMEIPVNPNILYRREIDLMGSYSSSYRLQ
SLAVDIVFNRRIDVQALISDRYPLQDLSAAVERAIAPTPETYKILIYP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacaggtatttagaggcgttaatcaactttcttacgaaaatatccccgtaccg
acactggaacccgatgaagtgctggtacaagtacaggtcgtcgggctatgtcaatcggat
atcaaaaaaattcgttatcctctgtatgaaccgccacgcatttttggacatgaaactgct
ggaaccatatcagcagtgggttctgaggtcaaaggctggcaagttggacaacgagtggcg
gttatgcaccacatcccttgtatgcgttgcgcctactgtctaaatgacaatttctcgatg
tgcgatgtctacaaaaacatatccaccacagcagggtttaatgctagcggcggcggtttt
gctgagtatgtcaaagttcctggtcacattgtgcgcaatggtgggttaattcccatcccc
gataatatcagttttgaagaagcaagttttgtagaaccaaccaactgctgccttaaggca
gtaaaaaaagcccgaattgccccaggtcaaacggttttgattactggtgccggaccaatt
gggttaatgtttatcatgttggtgaagtatttcggagcaaaggcgatcgccaccgactta
ctcccatcccgtattgaaaaagctttgaatgtaggcgcagaagcagcatttgatgcccgt
gatgccaatttacccgcaaaaattcatgagttgaccaatggtatgggtgttgatgtcgct
cttttagcagttcccagcgagaaagctttctttcaagccctcgactgtacccgcaaaggt
ggcaaaattctcttttttgctgagtttcctgatgaaatggaaatcccagtaaacccaaat
atcctgtaccgtcgggaaattgatttgatgggcagttatagttcatcctaccgccttcaa
agtttagcggttgatattgtctttaatcgacgaattgatgtccaagcgttgattagcgat
cgctatccattacaagacttgtcagcagcagtggaacgcgcgatcgcccccactccagag
acgtacaaaattttgatttatccctaa

DBGET integrated database retrieval system